1UGM: LC3

Crystal Structure of LC3. Determined by X-ray diffraction at 2.05 Å resolution. Released 6 Jul 2004.

Method: X-ray diffraction
Resolution: 2.05 Å
Organism: Rattus norvegicus
Chains: 1
Atoms: 1,008
Mol. weight: 14.58 kDa
Released: 6 Jul 2004

Explore 1UGM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1UGM contains 5 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	7-10	4
α-helix	13-26	14
β-strand	30-37	8	1
α-helix	45-47	3
β-strand	51-55	5	1
β-strand	59	1	2
α-helix	60-70	11
β-strand	80-83	4	1
β-strand	86-87	2	1
β-strand	94	1	2
α-helix	95-102	8
β-strand	109-114	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Microtubule-associated proteins 1A/1B light chain 3	A	protein	125	Rattus norvegicus	Q62625 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1UGM_1 Microtubule-associated proteins 1A/1B light chain 3 (chains A)
GPLGSMPSEKTFKQRRSFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVP
DHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESERDEDGFLYMVYAS
QETFG

Primary citation

The crystal structure of microtubule-associated protein light chain 3, a mammalian homologue of Saccharomyces cerevisiae Atg8. Sugawara, K., Suzuki, N.N., Fujioka, Y. et al. Genes Cells (2004) 9:611-618. DOI 10.1111/j.1356-9597.2004.00750.x · PubMed

Other PDB entries of the same protein (UniProt Q62625 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2Z0D 1.9 Å, The crystal structure of human Atg4B- LC3(1-120) complex
2Z0E 1.9 Å, The crystal structure of human Atg4B- LC3(1-124) complex
2ZZP 2.05 Å, The crystal structure of human Atg4B(C74S)- LC3(1-124) complex
2K6Q LC3 p62 complex structure

Browse structure collections

About this viewer

MolViewer shows 1UGM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.