2K6Q: LC3 p62 complex structure

LC3 p62 complex structure. Determined by solution NMR. Released 2 Sept 2008.

Method: Solution NMR
Organism: Rattus norvegicus
Chains: 2
Atoms: 1,131
Mol. weight: 16.13 kDa
Released: 2 Sept 2008

Explore 2K6Q in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2K6Q contains 3 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	13-26	14
β-strand	30-37	8	1
β-strand	51-55	5	1
β-strand	59	1	2
α-helix	60-71	12
β-strand	80-83	4	1
β-strand	86	1	1
β-strand	94	1	2
α-helix	95-100	6
β-strand	109-114	6	1

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	339-340	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Microtubule-associated proteins 1A/1B light chain 3B	A	protein	121	Rattus norvegicus	Q62625 (AlphaFold model)
p62_peptide from Sequestosome-1	B	protein	17	Rattus norvegicus	O08623 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2K6Q_1 Microtubule-associated proteins 1A/1B light chain 3B (chains A)
SMPSEKTFKQRRSFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVN
MSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESERDEDGFLYMVYASQETF
G

Sequence of entity 2 (B), FASTA

>2K6Q_2 p62_peptide from Sequestosome-1 (chains B)
MSGGDDDWTHLSSKEVD

Primary citation

Structural basis of target recognition by ATG8/LC3 during selective autophagy. Noda, N., Kumeta, H., Nakatogawa, H. et al. To be published.

Other PDB entries of the same protein (UniProt Q62625 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2Z0D 1.9 Å, The crystal structure of human Atg4B- LC3(1-120) complex
2Z0E 1.9 Å, The crystal structure of human Atg4B- LC3(1-124) complex
1UGM 2.05 Å, Crystal Structure of LC3
2ZZP 2.05 Å, The crystal structure of human Atg4B(C74S)- LC3(1-124) complex

Browse structure collections

About this viewer

MolViewer shows 2K6Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.