1UJL: HERG K+ channel S5-P extracellular linker

Solution Structure of the HERG K+ channel S5-P extracellular linker. Determined by solution NMR. Released 4 Nov 2003.

Method: Solution NMR
Chains: 1
Atoms: 322
Mol. weight: 4.59 kDa
Released: 4 Nov 2003

Explore 1UJL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1UJL contains 2 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	17-24	8
α-helix	36-41	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Potassium voltage-gated channel subfamily H member 2	A	protein	42		Q12809 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1UJL_1 Potassium voltage-gated channel subfamily H member 2 (chains A)
AIGNMEQPHMDSRIGWLHNLGDQIGKPYNSSGLGGPSIKDKY

Primary citation

Structure of the HERG K+ channel S5P extracellular linker: role of an amphipathic alpha-helix in C-type inactivation. Torres, A.M., Bansal, P.S., Sunde, M. et al. J Biol Chem (2003) 278:42136-42148. DOI 10.1074/jbc.M212824200 · PubMed

Other PDB entries of the same protein (UniProt Q12809 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4HQA 1.96 Å, Crystal structure of PAS domain from the human ERG (hERG) potassium channel
4HP9 2.12 Å, Crystal structure of the N-terminal truncated PAS domain from the hERG potassium channel
1BYW 2.6 Å, Structure of the N-terminal domain of the human-erg potassium channel
9CHQ 3.0 Å, Cryo-EM structure of the human ether-a-go-go related K+ channel (hERG) in 3 mM K+
8ZYQ 3.18 Å, Cryo-EM Structure of pimozide-bound hERG Channel
8ZYP 3.19 Å, Cryo-EM Structure of E-4031-bound hERG Channel
8ZYN 3.27 Å, Cryo-EM Structure of inhibitor-free hERG Channel
8ZYO 3.29 Å, Cryo-EM Structure of astemizole-bound hERG Channel
9CHP 3.3 Å, Cryo-EM structure of the human ether-a-go-go related K+ channel (hERG) in 300 mM K+
9CHS 3.4 Å, Cryo-EM structure of the human ether-a-go-go related K+ channel (hERG) in 3 mM K+…
8IO4 3.5 Å, Herg1a-herg1b open state
9CHR 3.5 Å, Cryo-EM structure of the human ether-a-go-go related K+ channel (hERG) in 300 mM K+…

Browse structure collections

About this viewer

MolViewer shows 1UJL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.