1UMI: Sugar-recognizing ubiquitin ligase

Name: PDB 1UMI: Structural basis of sugar-recognizing ubiquitin ligase
Published: 2004-04-06
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: ligase

Structural basis of sugar-recognizing ubiquitin ligase. Determined by X-ray diffraction at 2.4 Å resolution. Released 6 Apr 2004.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Mus musculus
Chains: 1
Atoms: 1,562
Mol. weight: 21.41 kDa
Released: 6 Apr 2004

Explore 1UMI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1UMI contains 5 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	117-123	7
β-strand	141-145	5	1
β-strand	151-154	4	2
α-helix	157	1
β-strand	171-174	4	2
α-helix	175	1
β-strand	180-187	8	1
α-helix	195-200	6
β-strand	204-212	9	2
β-strand	219-228	10	1
β-strand	234-239	6	1
β-strand	243-244	2	1
α-helix	245-246	2
β-strand	252-258	7	2
β-strand	267-276	10	1
β-strand	287-296	10	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
F-box only protein 2	A	protein	184	Mus musculus	Q80UW2 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1UMI_1 F-box only protein 2 (chains A)
GSHFYFLSKRRRNLLRNPAGEEDLEGWSDVEHGGDGWKVEELPGDNGVEFTQDDSVKKYF
ASSFEWCRKAQVIDLQAEGYWEELLDTTQPAIVVKDWYSGRTDAGSLYELTVRLLSENED
VLAEFATGQVAVPEDGSWMEISHTFIDYGPGVRFVRFEHGGQDSVYWKGWFGARVTNSSV
WVEP

Primary citation

Structural basis of sugar-recognizing ubiquitin ligase. Mizushima, T., Hirao, T., Yoshida, Y. et al. Nat Struct Mol Biol (2004) 11:365-370. DOI 10.1038/nsmb732 · PubMed

Other PDB entries of the same protein (UniProt Q80UW2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2RJ2 1.7 Å, Crystal Structure of the Sugar Recognizing SCF Ubiquitin Ligase at 1.7 Resolution
1UMH 2.0 Å, Structural basis of sugar-recognizing ubiquitin ligase
5B4N 2.3 Å, Structure analysis of function associated loop mutant of substrate recognition domain of…
2E31 2.4 Å, Structural basis for selection of glycosylated substrate by SCFFbs1 ubiquitin ligase
2E33 2.7 Å, Structural basis for selection of glycosylated substrate by SCFFbs1 ubiquitin ligase
2E32 3.52 Å, Structural basis for selection of glycosylated substrate by SCFFbs1 ubiquitin ligase

Browse structure collections

About this viewer

MolViewer shows 1UMI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.