1UN0: Yeast Karyopherin (Importin) alpha

Name: PDB 1UN0: Crystal Structure of Yeast Karyopherin (Importin) alpha in complex with a Nup2p N-terminal fragment
Published: 2003-10-16
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: nuclear import

Crystal Structure of Yeast Karyopherin (Importin) alpha in complex with a Nup2p N-terminal fragment. Determined by X-ray diffraction at 2.6 Å resolution. Released 16 Oct 2003.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: SACCHAROMYCES CEREVISIAE
Chains: 4
Atoms: 7,231
Mol. weight: 109.44 kDa
Released: 16 Oct 2003

Explore 1UN0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1UN0 contains 68 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 35 helices, 0 β-strands

Element	Residues	Length
α-helix	89-95	7
α-helix	101-114	14
α-helix	123-128	6
α-helix	132-137	6
α-helix	145-159	15
α-helix	163-171	9
α-helix	175-184	10
α-helix	187-201	15
α-helix	205-213	9
α-helix	217-222	6
α-helix	223-225	3
α-helix	229-243	15
α-helix	249-250	2
α-helix	252-255	4
α-helix	256-258	3
α-helix	259-265	7
α-helix	271-284	14
α-helix	289-297	9
α-helix	300-307	8
α-helix	313-326	14
α-helix	331-339	9
α-helix	342-349	8
α-helix	355-366	12
α-helix	373-381	9
α-helix	385-394	10
α-helix	397-410	14
α-helix	413-415	3
α-helix	418-426	9
α-helix	430-435	6
α-helix	436-438	3
α-helix	442-465	24
α-helix	472-479	8
α-helix	482-488	7
α-helix	489-491	3
α-helix	495-508	14

Chain B: 33 helices, 0 β-strands

Element	Residues	Length
α-helix	89-95	7
α-helix	101-115	15
α-helix	123-128	6
α-helix	132-137	6
α-helix	145-159	15
α-helix	163-171	9
α-helix	175-184	10
α-helix	187-202	16
α-helix	205-213	9
α-helix	217-222	6
α-helix	223-225	3
α-helix	229-243	15
α-helix	249-250	2
α-helix	252-255	4
α-helix	256-258	3
α-helix	259-265	7
α-helix	271-284	14
α-helix	289-297	9
α-helix	300-307	8
α-helix	313-326	14
α-helix	331-339	9
α-helix	342-349	8
α-helix	355-369	15
α-helix	373-381	9
α-helix	385-394	10
α-helix	397-410	14
α-helix	418-426	9
α-helix	430-436	7
α-helix	442-465	24
α-helix	472-479	8
α-helix	482-488	7
α-helix	489-491	3
α-helix	495-507	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Importin alpha subunit	A, B	protein	443	SACCHAROMYCES CEREVISIAE	Q02821 (AlphaFold model)
Nucleoporin NUP2	C, D	protein	51	SACCHAROMYCES CEREVISIAE	P32499 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1UN0_1 IMPORTIN ALPHA SUBUNIT (chains A, B)
ELPQMTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVPRLVEFMRENQPEML
QLEAAWALTNIASGTSAQTKVVVDADAVPLFIQLLYTGSVEVKEQAIWALGNVAGDSTDY
RDYVLQCNAMEPILGLFNSNKPSLIRTATWTLSNLCRGKKPQPDWSVVSQALPTLAKLIY
SMDTETLVDACWAISYLSDGPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGNIV
TGNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLIPP
LVKLLEVAEDKTKKEACWAISNASSGGLQRPDIIRYLVSQGCIKPLCDLLEIADNRIIEV
TLDALENILKMGEADKEARGLNINENADFIEKAGGMEKIFNCQQNENDKIYEKAYKIIET
YFGEEEDAVDETMAPQNAGNTFG

Sequence of entity 2 (C, D), FASTA

>1UN0_2 NUCLEOPORIN NUP2 (chains C, D)
MAKRVADAQIQRETYDSNESDDDVTPSTKVASSAVMNRRKIAMPKRRMAFK

Primary citation

Structural Basis for Nup2P Function in Cargo Release and Karyopherin Recycling in Nuclear Import. Matsuura, Y., Lange, A., Harreman, M.T. et al. EMBO J (2003) 22:5358. DOI 10.1093/EMBOJ/CDG538 · PubMed

Other PDB entries of the same protein (UniProt Q02821 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1WA5 2.0 Å, Structure of the Cse1:Imp-alpha:RanGTP complex
1EE4 2.1 Å, Crystal structure of yeast karyopherin (importin) alpha in a complex with a C-myc nls…
1BK5 2.2 Å, Karyopherin alpha from saccharomyces cerevisiae
5H2X 2.2 Å, Crystal structure of the karyopherin Kap60p bound to the SUMO protease Ulp1p (150-172)
4XZR 2.25 Å, Structure of yeast importin a bound to the membrane protein Nuclear Localization Signal…
1EE5 2.4 Å, Yeast karyopherin (importin) alpha in a complex with a nucleoplasmin nls peptide
4PVZ 2.5 Å, Structure of yeast importin a bound to the membrane protein Nuclear Localization Signal…
5H2W 2.5 Å, Crystal structure of the karyopherin Kap60p bound to the SUMO protease Ulp1p (150-340)
2C1T 2.6 Å, Structure of the Kap60p:Nup2 complex
5T94 2.63 Å, Crystal structure of Kap60 bound to yeast RCC1 (Prp20)
1BK6 2.8 Å, Karyopherin alpha (YEAST) + SV40 T antigen nls

Browse structure collections

About this viewer

MolViewer shows 1UN0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.