SeMet AfaE-3 adhesin from Escherichia Coli. Determined by X-ray diffraction at 3.28 Å resolution. Released 31 Aug 2004.
Explore 1USZ in 3D Show helices and sheets RCSB PDB PDBe
1USZ contains 2 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 1-16 | 16 | 1 |
| β-strand | 29-31 | 3 | 1 |
| α-helix | 32-34 | 3 | |
| β-strand | 40-47 | 8 | 1 |
| β-strand | 55-60 | 6 | 1 |
| β-strand | 65 | 1 | 1 |
| β-strand | 70-74 | 5 | 1 |
| β-strand | 80-87 | 8 | 1 |
| β-strand | 93-96 | 4 | 1 |
| β-strand | 99-102 | 4 | 1 |
| β-strand | 109-116 | 8 | 1 |
| α-helix | 123-124 | 2 | |
| β-strand | 126-138 | 13 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Afimbrial adhesin afa-III | A | protein | 149 | ESCHERICHIA COLI | Q57254 (AlphaFold model) |
>1USZ_1 AFIMBRIAL ADHESIN AFA-III (chains A) RGSHHHHHHGSFTPSGTTGTTKLTVTEECQVRVGDLTVAKTRGQLTDAAPIGPVTVQALG CNARQVALKADTDNFEQGKFFLISDNNRDKLYVNIRPMDNSAWTTDNGVFYKNDVGSWGG TIGIYVDGQQTNTPPGNYTLTLTGGYWAK
High Resolution Studies of the Afa/Dr Adhesin Drae and its Interaction with Chloramphenicol. Pettigrew, D., Anderson, K.L., Billington, J. et al. J Biol Chem (2004) 279:46851. DOI 10.1074/JBC.M409284200 · PubMed
Other PDB entries of the same protein (UniProt Q57254 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1USZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.