1UTU: Novel protein EMSY truncate

Crystal structure of novel protein EMSY truncate. Determined by X-ray diffraction at 2.0 Å resolution. Released 13 Oct 2005.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 1,635
Mol. weight: 24.47 kDa
Released: 13 Oct 2005

Explore 1UTU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1UTU contains 12 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	13-38	26
α-helix	43-55	13
α-helix	60-72	13
α-helix	74-84	11
α-helix	90-95	6
α-helix	98-101	4

Chain B: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	13-38	26
α-helix	41-42	2
α-helix	43-55	13
α-helix	60-71	12
α-helix	74-84	11
α-helix	90-95	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Emsy	A, B	protein	108	HOMO SAPIENS	Q7Z589 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1UTU_1 EMSY (chains A, B)
MPVVWPTLLDLSRDECKRILRKLELEAYAGVISALRAQGDLTKEKKDLLGELSKVLSIST
ERHRAEVRRAVNDERLTTIAHNMSGPNSSSEWSIEGRRLVPLMPRLVP

Primary citation

Binding of Emsy to Hp1Beta: Implications for Recruitment of Hp1Beta and Bs69. Ekblad, C.M., Chavali, G.B., Basu, B.P. et al. EMBO Rep (2005) 6:675. DOI 10.1038/SJ.EMBOR.7400415 · PubMed

Other PDB entries of the same protein (UniProt Q7Z589 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1UZ3 1.1 Å, Crystal structure of novel protein EMSY
2FMM 1.8 Å, Crystal Structure of EMSY-HP1 complex

Browse structure collections

About this viewer

MolViewer shows 1UTU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.