1UWO: Calcium form of human S100B, NMR, 20 structures

Calcium form of human S100B, NMR, 20 structures. Determined by solution NMR. Released 10 Jun 1998.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 1,482
Mol. weight: 21.19 kDa
Released: 10 Jun 1998

Explore 1UWO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1UWO contains 14 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	2-20	19
β-strand	28	1	1
α-helix	30-34	5
α-helix	35-39	5
α-helix	52-60	9
β-strand	67	1	1
α-helix	70-78	9
α-helix	79-83	5
α-helix	84-86	3

Chain B: 7 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	2-17	16
α-helix	29-34	6
α-helix	35-39	5
α-helix	52-59	8
β-strand	61	1	2
β-strand	68	1	2
α-helix	70-78	9
α-helix	79-83	5
α-helix	84-88	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
S100B	A, B	protein	91	Homo sapiens	P04271 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1UWO_1 S100B (chains A, B)
SELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETL
DNDGDGECDFQEFMAFVAMVTTACHEFFEHE

Primary citation

A novel calcium-sensitive switch revealed by the structure of human S100B in the calcium-bound form. Smith, S.P., Shaw, G.S. Structure (1998) 6:211-222. DOI 10.1016/S0969-2126(98)00022-7 · PubMed

Other PDB entries of the same protein (UniProt P04271 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5D7F 1.3 Å, X-ray structure of Ca(2+)-S100B with human RAGE-derived W72 peptide
3CZT 1.4 Å, Crystal Structure of S100B in the Calcium and Zinc Loaded State at pH 9
3D0Y 1.5 Å, Crystal Structure of S100B in the Calcium and Zinc Loaded State at pH 6.5
3D10 1.65 Å, Crystal Structure of S100B in the Calcium and Zinc Loaded State at pH 10.0
2H61 1.9 Å, X-ray structure of human Ca2+-loaded S100B
3HCM 2.0 Å, Crystal structure of human S100B in complex with S45
5CSI 2.13 Å, S100B-RSK1 crystal structure A'
5CSF 2.4 Å, S100B-RSK1 crystal structure A
4XYN 2.55 Å, X-ray structure of Ca(2+)-S100B with human RAGE-derived W61 peptide
5CSJ 2.7 Å, S100B-RSK1 crystal structure B
5CSN 2.95 Å, S100B-RSK1 crystal structure C
1MQ1 Ca2+-S100B-TRTK-12 complex

Browse structure collections

About this viewer

MolViewer shows 1UWO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.