Crystal Structure of S100B in the Calcium and Zinc Loaded State at pH 10.0. Determined by X-ray diffraction at 1.65 Å resolution. Released 14 Apr 2009.
Explore 3D10 in 3D Show helices and sheets RCSB PDB PDBe
3D10 contains 10 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-18 | 17 | |
| β-strand | 27 | 1 | 1 |
| α-helix | 29-39 | 11 | |
| α-helix | 45-47 | 3 | |
| α-helix | 50-60 | 11 | |
| β-strand | 68 | 1 | 1 |
| α-helix | 70-87 | 18 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein S100-B | A, B | protein | 92 | Homo sapiens | P04271 (AlphaFold model) |
>3D10_1 Protein S100-B (chains A, B) MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMET LDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
Water and common crystallization additives (PGE) are not listed.
The crystal structures of human S100B in the zinc- and calcium-loaded state at three pH values reveal zinc ligand swapping. Ostendorp, T., Diez, J., Heizmann, C.W. et al. Biochim Biophys Acta (2011) 1813:1083-1091. DOI 10.1016/j.bbamcr.2010.10.006 · PubMed
Other PDB entries of the same protein (UniProt P04271 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3D10 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.