1UZ3: Novel protein EMSY

Crystal structure of novel protein EMSY. Determined by X-ray diffraction at 1.1 Å resolution. Released 13 Oct 2005.

Method: X-ray diffraction
Resolution: 1.1 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 1,921
Mol. weight: 22.95 kDa
Released: 13 Oct 2005

Explore 1UZ3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1UZ3 contains 11 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	9-11	3
α-helix	15-40	26
α-helix	45-57	13
α-helix	62-73	12
α-helix	76-86	11
α-helix	92-99	8

Chain B: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	10-40	31
α-helix	45-57	13
α-helix	62-74	13
α-helix	76-85	10
α-helix	94-99	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Emsy protein	A, B	protein	102	HOMO SAPIENS	Q7Z589 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1UZ3_1 EMSY PROTEIN (chains A, B)
GSMPVVWPTLLDLSRDECKRILRKLELEAYAGVISALRAQGDLTKEKKDLLGELSKVLSI
STERHRAEVRRAVNDERLTTIAHNMSGPNSSSEWSIEGRRLV

Primary citation

Crystal Structure of the Ent Domain of Human Emsy. Chavali, G.B., Ekblad, C.M., Basu, B.P. et al. J Mol Biol (2005) 350:964. DOI 10.1016/J.JMB.2005.05.047 · PubMed

Other PDB entries of the same protein (UniProt Q7Z589 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2FMM 1.8 Å, Crystal Structure of EMSY-HP1 complex
1UTU 2.0 Å, Crystal structure of novel protein EMSY truncate

Browse structure collections

About this viewer

MolViewer shows 1UZ3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.