Solution Structure of Anticodon Binding Domain from Nuclear Receptor Coactivator 5 (Human KIAA1637 Protein). Determined by solution NMR. Released 20 Jul 2004.
Explore 1V95 in 3D Show helices and sheets RCSB PDB PDBe
1V95 contains 6 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 11-15 | 5 | 1 |
| α-helix | 19-21 | 3 | |
| α-helix | 22-32 | 11 | |
| β-strand | 38-42 | 5 | 1 |
| α-helix | 49-59 | 11 | |
| β-strand | 63-67 | 5 | 1 |
| α-helix | 69-70 | 2 | |
| α-helix | 71-75 | 5 | |
| β-strand | 76-81 | 6 | 1 |
| β-strand | 88-93 | 6 | 1 |
| α-helix | 94-113 | 20 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Nuclear receptor coactivator 5 | A | protein | 130 | Homo sapiens | Q9HCD5 (AlphaFold model) |
>1V95_1 Nuclear receptor coactivator 5 (chains A) GSSGSSGPVDCSVIVVNKQTKDYAESVGRKVRDLGMVVDLIFLNTEVSLSQALEDVSRGG SPFAIVITQQHQIHRSCTVNIMFGTPQEHRNMPQADAMVLVARNYERYKNECREKEREEI ARQASGPSSG
Solution Structure of Anticodon Binding Domain from Nuclear Receptor Coactivator 5 (Human KIAA1637 Protein). Zhao, C., Kigawa, T., Tochio, N. et al. To be published.
Other PDB entries of the same protein (UniProt Q9HCD5 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1V95 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.