1VHH: Sonic hedgehog

A potential catalytic site within the amino-terminal signalling domain of sonic hedgehog. Determined by X-ray diffraction at 1.7 Å resolution. Released 29 Jan 1996.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Mus musculus
Chains: 1
Atoms: 1,382
Mol. weight: 18.71 kDa
Ligands: ZN
Released: 29 Jan 1996

Explore 1VHH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1VHH contains 8 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	41-44	4
β-strand	48-49	2	1
α-helix	72-76	5
β-strand	78-79	2	2
β-strand	85-87	3	1
α-helix	95-97	3
β-strand	98-99	2	2
α-helix	101-117	17
β-strand	123-127	5	1
α-helix	140-143	4
β-strand	146-151	6	1
α-helix	156-158	3
α-helix	159-168	10
β-strand	173-178	6	1
β-strand	181-185	5	1
α-helix	189-192	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sonic hedgehog	A	protein	162	Mus musculus	Q62226 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1VHH_1 SONIC HEDGEHOG (chains A)
RRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENT
GADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSD
RDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAK

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1

Water and common crystallization additives (SO4) are not listed.

Primary citation

A potential catalytic site revealed by the 1.7-A crystal structure of the amino-terminal signalling domain of Sonic hedgehog. Hall, T.M., Porter, J.A., Beachy, P.A. et al. Nature (1995) 378:212-216. DOI 10.1038/378212a0 · PubMed

Other PDB entries of the same protein (UniProt Q62226 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3D1M 1.7 Å, Crystal Structure of Sonic Hedgehog Bound to the third FNIII domain of CDO
4C4M 1.74 Å, Crystal structure of the Sonic Hedgehog-chondroitin-4-sulphate complex
3N1R 2.13 Å, Crystal Structure of ShhN
4C4N 2.36 Å, Crystal structure of the Sonic Hedgehog-heparin complex
7RPK 2.7 Å, Cryo-EM structure of murine Dispatched in complex with Sonic hedgehog
2WG4 3.15 Å, Crystal structure of the complex between human hedgehog-interacting protein HIP and…
2WFX 3.2 Å, Crystal structure of the complex between human hedgehog-interacting protein HIP and…

Browse structure collections

About this viewer

MolViewer shows 1VHH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.