3N1R: ShhN

Crystal Structure of ShhN. Determined by X-ray diffraction at 2.13 Å resolution. Released 2 Jun 2010.

Method: X-ray diffraction
Resolution: 2.13 Å
Organism: Mus musculus
Chains: 1
Atoms: 1,254
Mol. weight: 18.14 kDa
Ligands: ZN, CA
Released: 2 Jun 2010

Explore 3N1R in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3N1R contains 6 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	42-44	3
β-strand	48-49	2	1
α-helix	72-76	5
β-strand	78-79	2	2
β-strand	85-87	3	1
α-helix	95-97	3
β-strand	98-99	2	2
α-helix	101-117	17
β-strand	123-127	5	1
α-helix	140-143	4
β-strand	146-151	6	1
α-helix	159-168	10
β-strand	173-178	6	1
β-strand	181-185	5	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sonic hedgehog protein	A	protein	160	Mus musculus	Q62226 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3N1R_1 Sonic hedgehog protein (chains A)
GSGPLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGA
DRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRD
RSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAK

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1
CA	Calcium ion	Ca	1

Primary citation

Crystal Structure of ShhN. Kavran, J.M., Ward, M.D., Oladosu, O.O. et al. To be published.

Other PDB entries of the same protein (UniProt Q62226 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1VHH 1.7 Å, A potential catalytic site within the amino-terminal signalling domain of sonic hedgehog
3D1M 1.7 Å, Crystal Structure of Sonic Hedgehog Bound to the third FNIII domain of CDO
4C4M 1.74 Å, Crystal structure of the Sonic Hedgehog-chondroitin-4-sulphate complex
4C4N 2.36 Å, Crystal structure of the Sonic Hedgehog-heparin complex
7RPK 2.7 Å, Cryo-EM structure of murine Dispatched in complex with Sonic hedgehog
2WG4 3.15 Å, Crystal structure of the complex between human hedgehog-interacting protein HIP and…
2WFX 3.2 Å, Crystal structure of the complex between human hedgehog-interacting protein HIP and…

Browse structure collections

About this viewer

MolViewer shows 3N1R directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.