1VRC: PTS system, mannose-specific IIAB component

Name: PDB 1VRC: Complex of enzyme IIAmannose and the histidine-containing phosphocarrier protein HPr from escherichia coli nmr, restrained regularized mean structure
Published: 2005-04-19
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transferase

Complex of enzyme IIAmannose and the histidine-containing phosphocarrier protein HPr from escherichia coli nmr, restrained regularized mean structure. Determined by solution NMR. Released 19 Apr 2005.

Method: Solution NMR
Organism: Escherichia coli
Chains: 4
Atoms: 3,258
Mol. weight: 47.93 kDa
Ligands: PO3
Released: 19 Apr 2005

Explore 1VRC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1VRC contains 16 α-helices and 22 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	4-8	5	1
α-helix	13-25	13
β-strand	31-34	4	1
β-strand	38	1	2
β-strand	40	1	2
α-helix	42-53	12
β-strand	62-66	5	1
α-helix	72-81	10
β-strand	87-91	5	1
α-helix	95-105	11
α-helix	111-124	14
β-strand	127-128	2	3

Chains C and D: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	202-207	6	5
α-helix	217-226	10
β-strand	232-237	6	5
β-strand	240-243	4	5
α-helix	247-250	4
β-strand	260-266	7	5
α-helix	270-283	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
PTS system, mannose-specific IIAB component	A, B	protein	136	Escherichia coli	P69797 (AlphaFold model)
Phosphocarrier protein HPr	C, D	protein	85	Escherichia coli	P0AA04 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1VRC_1 PTS system, mannose-specific IIAB component (chains A, B)
MTIAIVIGTHGWAAEQLLKTAEMLLGEQENVGWIDFVPGENAETLIEKYNAQLAKLDTTK
GVLFLVDTWGGSPFNAASRIVVDKEHYEVIAGVNIPMLVETLMARDDDPSFDELVALAVE
TGREGVKALKAKPFAG

Sequence of entity 2 (C, D), FASTA

>1VRC_2 Phosphocarrier protein HPr (chains C, D)
MFQQEVTITAPNGLHTRPAAQFVKEAKGFTSEITVTSNGKSASAKSLFKLQTLGLTQGTV
VTISAEGEDEQKAVEHLVKLMAELE

Ligands and cofactors

ID	Name	Formula	Copies
PO3	Phosphite ion	O3 P	2

Primary citation

Solution NMR structure of the 48-kDa IIAMannose-HPr complex of the Escherichia coli mannose phosphotransferase system. Williams, D.C., Cai, M., Suh, J.Y. et al. J Biol Chem (2005) 280:20775-20784. DOI 10.1074/jbc.M501986200 · PubMed

Other PDB entries of the same protein (UniProt P69797 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1PDO 1.7 Å, Phosphoenolpyruvate-dependent phosphotransferase system
1VSQ Solution NMR structure of the productive complex between IIAMannose and IIBMannose of…
2JZH structure of IIB domain of the mannose transporter of E. coli
2JZN Solution NMR structure of the productive complex between IIAMannose and IIBMannose of…
2JZO Solution NMR structure of the non-productive complex between IIAMannose and IIBMannose…

Browse structure collections

About this viewer

MolViewer shows 1VRC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.