1VYV: Beta4 subunit of Ca2+ channel

beta4 subunit of Ca2+ channel. Determined by X-ray diffraction at 3.0 Å resolution. Released 15 Jun 2004.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: RATTUS NORVEGICUS
Chains: 2
Atoms: 4,361
Mol. weight: 80.75 kDa
Released: 15 Jun 2004

Explore 1VYV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1VYV contains 24 α-helices and 29 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	72-88	17
β-strand	94-98	5	1
β-strand	102	1	2
β-strand	116	1	1
β-strand	119	1	2
β-strand	124-132	9	1
β-strand	135-140	6	1
β-strand	148-151	4	1
α-helix	153-161	9
β-strand	212-215	4	1
α-helix	219-220	2
β-strand	221-224	4	3
α-helix	232-248	17
β-strand	253-258	6	3
α-helix	262-264	3
α-helix	288-302	15
β-strand	307-312	6	3
α-helix	318-321	4
β-strand	329-333	5	3
α-helix	338-346	9
α-helix	350-353	4
α-helix	356-367	12
α-helix	371-373	3
β-strand	376-378	3	3
α-helix	383-401	19

Chain B: 12 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	72-85	14
β-strand	94-98	5	4
β-strand	102	1	5
β-strand	116	1	4
β-strand	119	1	5
β-strand	124-132	9	4
β-strand	135-140	6	4
α-helix	145-147	3
β-strand	148-151	4	4
α-helix	153-161	9
β-strand	212-214	3	4
β-strand	221-224	4	6
α-helix	232-248	17
β-strand	253-254	2	7
β-strand	257-258	2	8
α-helix	262-264	3
α-helix	288-302	15
β-strand	307-308	2	7
β-strand	309-310	2	6
β-strand	311-312	2	8
α-helix	318-321	4
β-strand	329-333	5	6
α-helix	338-346	9
α-helix	350-353	4
α-helix	356-367	12
α-helix	371-373	3
β-strand	376-378	3	6
α-helix	383-399	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Calcium channel beta-4SUBUNIT	A, B	protein	359	RATTUS NORVEGICUS	D4A055 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1VYV_1 CALCIUM CHANNEL BETA-4SUBUNIT (chains A, B)
GSADSYTSRPSDSDVSLEEDREAIRQEREQQAAIQLERAKSKPVAFAVKTNVSYCGALDE
DVPVPSSAVSFDAKDFLHIKEKYNNDWWIGRLVKEGCEIGFIPSPLRLENIRIQQEQKRK
RFHGGKSSGNSSSSLGEMVSGTFRATPTTTAKQKQKVTKHIPPYDVVPSMRPVVLVGPSL
KGYEVTDMMQKALFDFLKHRFDGRISITRVTADISLAKRSVLNNPSKRAIIERSNTKSSL
AEVQSEIERIFELARSLQLVVLDADTINHPAQLIKTSLAPIIVHVKVSSPKVLQRLIKSR
GKSQSKHLNVQLVAADKLAQCPPEMFDVILDENQLEDACEHLGEYLEAYWRATHTSSST

Primary citation

Structural Basis of the Alpha(1)-Beta Subunit Interaction of Voltage-Gated Ca(2+) Channels. Chen, Y.-H., Li, M.-H., Zhang, Y. et al. Nature (2004) 429:675. DOI 10.1038/NATURE02641 · PubMed

Other PDB entries of the same protein (UniProt D4A055 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6HW2 1.94 Å, The Crystal Structure of CaV beta4c in complex with HP1gamma chromo shadow domains

Browse structure collections

About this viewer

MolViewer shows 1VYV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.