1W0T: HTRF1 DNA-binding domain

hTRF1 DNA-binding domain in complex with telomeric DNA. Determined by X-ray diffraction at 2.0 Å resolution. Released 22 Dec 2004.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: HOMO SAPIENS
Chains: 4
Atoms: 1,759
Mol. weight: 24.91 kDa
Released: 22 Dec 2004

Explore 1W0T in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1W0T contains 8 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	382-384	3
α-helix	385-398	14
α-helix	403-409	7
α-helix	417-428	12

Chain B: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	382-384	3
α-helix	385-398	14
α-helix	403-409	7
α-helix	417-429	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Telomeric repeat binding factor 1	A, B	protein	53	HOMO SAPIENS	P54274 (AlphaFold model)
5'-d(cptpgptptpapgpgpgptp tpapgpgpgptptpap*g)-3'	C	DNA	19
5'-d(tpcptpapapcpcpcptpap apcpcpcptpapapcp*a)-3'	D	DNA	19

Sequence of entity 1 (A, B), FASTA

>1W0T_1 TELOMERIC REPEAT BINDING FACTOR 1 (chains A, B)
KRQAWLWEEDKNLRSGVRKYGEGNWSKILLHYKFNNRTSVMLKDRWRTMKKLK

Sequence of entity 2 (C), FASTA

>1W0T_2 5'-D(*CP*TP*GP*TP*TP*AP*GP*GP*GP*TP *TP*AP*GP*GP*GP*TP*TP*AP*G)-3' (chains C)
CTGTTAGGGTTAGGGTTAG

Sequence of entity 3 (D), FASTA

>1W0T_3 5'-D(*TP*CP*TP*AP*AP*CP*CP*CP*TP*AP *AP*CP*CP*CP*TP*AP*AP*CP*A)-3' (chains D)
TCTAACCCTAACCCTAACA

Primary citation

How the Human Telomeric Proteins Trf1 and Trf2 Recognize Telomeric DNA: A View from High-Resolution Crystal Structures. Court, R.I., Chapman, L.M., Fairall, L. et al. EMBO Rep (2005) 6:39. DOI 10.1038/SJ.EMBOR.7400314 · PubMed

Other PDB entries of the same protein (UniProt P54274 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9HCZ 1.55 Å, Crystal structure of human TRF1 TRFH domain in complex with compound 6
9HCX 1.69 Å, Crystal structure of human TRF1 TRFH domain in complex with compound 53
9HCP 1.7 Å, Crystal structure of human TRF1 TRFH domain in complex with compound 15
9HCT 1.7 Å, Crystal structure of human TRF1 TRFH domain in complex with compound 50
9HD1 1.73 Å, Crystal structure of human TRF1 TRFH domain in complex with compound 59
9HCL 1.87 Å, Crystal structure of human TRF1 TRFH domain in complex with compound 12
9HD9 1.87 Å, Crystal structure of human TRF1 TRFH domain in complex with compound 1
9HF9 1.9 Å, Crystal structure of human TRF1 TRFH domain in complex with compound 5
9HCN 1.93 Å, Crystal structure of human TRF1 TRFH domain in complex with compound 46
9HCY 1.93 Å, Crystal structure of human TRF1 TRFH domain in complex with compound 54
9HD0 1.93 Å, Crystal structure of human TRF1 TRFH domain in complex with compound 55
9HCR 1.93 Å, Crystal structure of human TRF1 TRFH domain in complex with compound 48

Browse structure collections

About this viewer

MolViewer shows 1W0T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.