1WAK: SRPK1

X-ray structure of SRPK1. Determined by X-ray diffraction at 1.73 Å resolution. Released 11 Jul 2006.

Method: X-ray diffraction
Resolution: 1.73 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 3,180
Mol. weight: 45.54 kDa
Released: 11 Jul 2006

Explore 1WAK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1WAK contains 23 α-helices and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 23 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	75-76	2	1
β-strand	80-88	9	1
β-strand	92-99	8	1
β-strand	104-111	8	1
α-helix	115-133	19
α-helix	139-143	5
β-strand	144	1	2
β-strand	147-155	9	1
β-strand	158-165	8	1
β-strand	171	1	2
α-helix	172-178	7
α-helix	186-201	16
α-helix	202-207	6
β-strand	209-210	2	3
α-helix	216-218	3
β-strand	219-221	3	2
α-helix	225-235	11
α-helix	485-490	6
β-strand	493-495	3	2
α-helix	498-500	3
β-strand	502-503	2	3
β-strand	506	1	3
α-helix	515-517	3
α-helix	520-524	5
α-helix	531-546	16
α-helix	561-573	13
α-helix	576-577	2
α-helix	578-583	6
α-helix	587-589	3
β-strand	591	1	4
β-strand	597	1	4
α-helix	608-614	7
α-helix	620-630	11
α-helix	631-634	4
α-helix	638-640	3
α-helix	642-643	2
α-helix	644-648	5
α-helix	651-654	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Serine/threonine-protein kinase SPRK1	A	protein	397	HOMO SAPIENS	Q96SB4 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1WAK_1 SERINE/THREONINE-PROTEIN KINASE SPRK1 (chains A)
PEQEEEILGSDDDEQEDPNDYCKGGYHLVKIGDLFNGRYHVIRKLGWGHFSTVWLSWDIQ
GKKFVAMKVVKSAEHYTETALDEIRLLKSVRNSDPNDPNREMVVQLLDDFKISGVNGTHI
CMVFEVLGHHLLKWIIKSNYQGLPLPCVKKIIQQVLQGLDYLHTKCRIIHTDIKPENILL
SVNEQYIRRLAAEATEWQRSGAPPPSGSAVSTAPATAGNFLVNPLEPKNAEKLKVKIADL
GNACWVHKHFTEDIQTRQYRSLEVLIGSGYNTPADIWSTACMAFELATGDYLFEPHSGEE
YTRDEDHIALIIELLGKVPRKLIVAGKYSKEFFTKKGDLKHITKLKPWGLFEVLVEKYEW
SQEEAAGFTDFLLPMLELIPEKRATAAECLRHPWLNS

Primary citation

Sr Protein Kinase 1 is Resilient to Inactivation. Ngo, J.C., Gullingsrud, J., Giang, K. et al. Structure (2007) 15:123. DOI 10.1016/J.STR.2006.11.011 · PubMed

Other PDB entries of the same protein (UniProt Q96SB4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5NNG 1.2 Å, Crystal Structure of the first bromodomain of human BRD4 in complex with an acetylated…
5MY8 1.7 Å, Crystal structure of SRPK1 in complex with SPHINX31
5MXX 1.75 Å, Crystal structure of human SR protein kinase 1 (SRPK1) in complex with compound 1
4WUA 2.0 Å, Crystal structure of human SRPK1 complexed to an inhibitor SRPIN340
7DD1 2.05 Å, Crystal structure of SRPK1 in complex with a peptide inhibitor
7PQS 2.2 Å, SRPK1 in complex with MSC2711186
7ZKS 2.28 Å, SRPK1 in complex with inhibitor
5XV7 2.32 Å, SRPK1 in complex with Alectinib
1WBP 2.4 Å, SRPK1 bound to 9mer docking motif peptide
6FAD 2.8 Å, SR protein kinase 1 (SRPK1) in complex with the RGG-box of HSV1 ICP27
3BEG 2.9 Å, Crystal structure of SR protein kinase 1 complexed to its substrate ASF/SF2

Browse structure collections

About this viewer

MolViewer shows 1WAK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.