1WG3: Anti-silencing protein 1

Structural analysis of yeast nucleosome-assembly factor CIA1p. Determined by X-ray diffraction at 3.0 Å resolution. Released 14 Jun 2005.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 1,426
Mol. weight: 19.59 kDa
Released: 14 Jun 2005

Explore 1WG3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1WG3 contains 5 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	11-17	7	1
β-strand	24	1	2
α-helix	28	1
β-strand	29-37	9	1
β-strand	45-52	8	2
β-strand	62-69	8	2
β-strand	75-83	9	1
α-helix	84-87	4
α-helix	88-90	3
β-strand	99-108	10	2
β-strand	111-124	14	2
α-helix	128-130	3
α-helix	139-141	3
β-strand	142-146	5	2
β-strand	152-155	4	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Anti-silencing protein 1	A	protein	175	Saccharomyces cerevisiae	P32447 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1WG3_1 Anti-silencing protein 1 (chains A)
ASGSSGMSIVSLLGIKVLNNPAKFTDPYEFEITFECLESLKHDLEWKLTYVGSSRSLDHD
QELDSILVGPVPVGVNKFVFSADPPSAELIPASELVSVTVILLSCSYDGREFVRVGYYVN
NEYDEEELRENPPAKVQVDHIVRNILAEKPRVTRFNIVWDNENEGDLYPPEQPGV

Primary citation

Structural Similarity between Histone Chaperone Cia1p/Asf1p and DNA-Binding Protein NF-{kappa}B. Padmanabhan, B., Kataoka, K., Umehara, T. et al. J Biochem (2005) 138:821-829. DOI 10.1093/jb/mvi182 · PubMed

Other PDB entries of the same protein (UniProt P32447 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1ROC 1.5 Å, Crystal structure of the histone deposition protein Asf1
5UCB 1.52 Å, Structure of antigen-Fab complex with engineered switch residue region.
2HUE 1.7 Å, Structure of the H3-H4 chaperone Asf1 bound to histones H3 and H4
5UEK 1.7 Å, Structure of antigen-Fab 12E complex with Histone chaperone ASF1
5UEA 1.7 Å, Structure of antigen-Fab complex with Histone chaperone ASF1
6AYZ 2.1 Å, Crystal structure of Asf1-Fab 12E complex
2IDC 2.2 Å, Structure of the Histone H3-Asf1 Chaperone Interaction
4ZBJ 2.25 Å, UBN1 peptide bound to H3.3/H4/Asf1
4EO5 2.35 Å, Yeast Asf1 bound to H3/H4G94P mutant
5EII 2.44 Å, Structural determination of an protein complex of a Fab with increased solubility
6AZ2 2.48 Å, Crystal structure of Asf1-Fab 12E complex
4RRP 2.79 Å, Crystal Structure of the Fab complexed with antigen Asf1p, Northeast Structural Genomics…

Browse structure collections

About this viewer

MolViewer shows 1WG3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.