Ribosomal protein L14. Determined by X-ray diffraction at 1.5 Å resolution. Released 17 Aug 1996.
Explore 1WHI in 3D Show helices and sheets RCSB PDB PDBe
1WHI contains 2 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2 | 1 | 1 |
| β-strand | 7-10 | 4 | 2 |
| β-strand | 12 | 1 | 3 |
| β-strand | 16-24 | 9 | 2 |
| β-strand | 33 | 1 | 1 |
| β-strand | 38-46 | 9 | 2 |
| β-strand | 57-64 | 8 | 2 |
| β-strand | 69-70 | 2 | 4 |
| β-strand | 76-77 | 2 | 4 |
| β-strand | 83-87 | 5 | 2 |
| β-strand | 93 | 1 | 2 |
| β-strand | 98 | 1 | 3 |
| β-strand | 102 | 1 | 5 |
| α-helix | 105-108 | 4 | |
| α-helix | 112-117 | 6 | |
| β-strand | 121 | 1 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ribosomal protein L14 | A | protein | 122 | Geobacillus stearothermophilus | P04450 (AlphaFold model) |
>1WHI_1 RIBOSOMAL PROTEIN L14 (chains A) MIQQESRLKVADNSGAREVLVIKVLGGSGRRYANIGDVVVATVKDATPGGVVKKGQVVKA VVVRTKRGVRRPDGSYIRFDENACVIIRDDKSPRGTRIFGPVARELRDKDFMKIISLAPE VI
The crystal structure of ribosomal protein L14 reveals an important organizational component of the translational apparatus. Davies, C., White, S.W., Ramakrishnan, V. Structure (1996) 4:55-66. DOI 10.1016/S0969-2126(96)00009-3 · PubMed
Other PDB entries of the same protein (UniProt P04450 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1WHI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.