1WJU: NEDD8 ultimate buster-1

Solution structure of N-terminal ubiquitin-like domain of human NEDD8 ultimate buster-1. Determined by solution NMR. Released 29 Nov 2004.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 774
Mol. weight: 11.04 kDa
Released: 29 Nov 2004

Explore 1WJU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1WJU contains 4 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	15-21	7	1
β-strand	32-37	6	1
β-strand	41	1	2
α-helix	42-52	11
β-strand	61-64	4	1
β-strand	67-68	2	1
β-strand	74	1	2
α-helix	75-78	4
β-strand	84-89	6	1
α-helix	91-93	3
α-helix	98-99	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
NEDD8 ultimate buster-1	A	protein	100	Homo sapiens	Q9Y5A7 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1WJU_1 NEDD8 ultimate buster-1 (chains A)
GSSGSSGDNYRTTGIATIEVFLPPRLKKDRKNLLETRLHITGRELRSKIAETFGLQENYI
KIVINKKQLQLGKTLEEQGVAHNVKAMVLELKQSSGPSSG

Primary citation

Solution structure of N-terminal ubiquitin-like domain of human NEDD8 ultimate buster-1. Yoneyama, M., Koshiba, S., Tochio, N. et al. To be published.

Other PDB entries of the same protein (UniProt Q9Y5A7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8USD 2.7 Å, Rpn1/Nub1UBL-focused alignment of the non-substrate-engaged human 26S proteasome
9E8I 2.87 Å, Human proteasome in resting state conformation bound to TXNL1 in Forward conformation
9E8H 2.9 Å, Human proteasome in resting state conformation bound to TXNL1 in backward conformation
9E8G 3.01 Å, Nub1/Fat10-processing human 26S proteasome bound to Txnl1 with Rpt5 at top of spiral…
8USC 3.1 Å, Nub1/Fat10-processing human 26S proteasome
9E8J 3.47 Å, Nub1/Fat10-processing human 26S proteasome bound to Txnl1 with Rpt1 at top of spiral…
9E8L 3.59 Å, Nub1/Fat10-processing human 26S proteasome bound to Txnl1 with Rpt4 at top of spiral…

Browse structure collections

About this viewer

MolViewer shows 1WJU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.