1WLN: FHA domain of mouse Afadin 6

Solution structure of the FHA domain of mouse Afadin 6. Determined by solution NMR. Released 12 Jul 2005.

Method: Solution NMR
Organism: Mus musculus
Chains: 1
Atoms: 909
Mol. weight: 12.99 kDa
Released: 12 Jul 2005

Explore 1WLN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1WLN contains 1 α-helix and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 10 β-strands

Element	Residues	Length	Sheet
α-helix	8-10	3
β-strand	13-17	5	1
β-strand	30-32	3	1
β-strand	36-39	4	2
β-strand	62-66	5	2
β-strand	71-75	5	2
β-strand	82-84	3	1
β-strand	88	1	1
β-strand	93-95	3	2
β-strand	100-103	4	1
β-strand	107-112	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Afadin	A	protein	120	Mus musculus	Q9QZQ1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1WLN_1 Afadin (chains A)
GSSGSSGPEKLPYLVELSPDGSDSRDKPKLYRLQLSVTEVGTEKFDDNSIQLFGPGIQPH
HCDLTNMDGVVTVTPRSMDAETYVDGQRISETTMLQSGMRLQFGTSHVFKFVDPSGPSSG

Primary citation

Solution structure of the FHA domain of mouse Afadin 6. Hayashi, F., Hirata, Y., Guentert, P. et al. To be published.

Other PDB entries of the same protein (UniProt Q9QZQ1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6AMB 2.5 Å, Crystal Structure of the Afadin RA1 domain in complex with HRAS
3AXA 2.78 Å, Crystal structure of afadin PDZ domain in complex with the C-terminal peptide from…
9DVA 3.1 Å, F-actin binding interface of alpha-E-catenin ABD (cadherin-catenin complex) and afadin
1WXA Solution Structure of Ras-binding Domain in Mouse AF-6 Protein

Browse structure collections

About this viewer

MolViewer shows 1WLN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.