Crystal structure of afadin PDZ domain in complex with the C-terminal peptide from nectin-3. Determined by X-ray diffraction at 2.78 Å resolution. Released 25 Apr 2012.
Explore 3AXA in 3D Show helices and sheets RCSB PDB PDBe
3AXA contains 6 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-9 | 7 | 1 |
| β-strand | 11 | 1 | 2 |
| β-strand | 13 | 1 | 2 |
| β-strand | 16-22 | 7 | 1 |
| β-strand | 29-36 | 8 | 1 |
| β-strand | 37 | 1 | 3 |
| α-helix | 41-45 | 5 | |
| β-strand | 53-57 | 5 | 1 |
| β-strand | 60-61 | 2 | 1 |
| α-helix | 67-75 | 9 | |
| β-strand | 80-86 | 7 | 1 |
| α-helix | 87-89 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Afadin, Nectin-3 | A, B | protein | 106 | Mus musculus | Q9JLB9 (AlphaFold model), Q9QZQ1 (AlphaFold model) |
>3AXA_1 Afadin, Nectin-3 (chains A, B) GPLGSDHKEPEIITVTLKKQNGMGLSIVAAKGAGQDKLGIYVKSVVKGGAADVDGRLAAG DQLLSVDGRSLVGLSQERAAELMTRTSSVVTLEVAKQGAIRREWYV
Crystal structure of afadin PDZ domain-nectin-3 complex shows the structural plasticity of the ligand-binding site. Fujiwara, Y., Goda, N., Tamashiro, T. et al. Protein Sci (2015) 24:376-385. DOI 10.1002/pro.2628 · PubMed
Other PDB entries of the same protein (UniProt Q9JLB9 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3AXA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.