1WR1: Ubiquitin

The complex structure of Dsk2p UBA with ubiquitin. Determined by solution NMR. Released 19 Apr 2005.

Method: Solution NMR
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 1,036
Mol. weight: 14.75 kDa
Released: 19 Apr 2005

Explore 1WR1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1WR1 contains 7 α-helices and 7 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	1
β-strand	12-15	4	1
β-strand	22	1	2
α-helix	23-30	8
β-strand	41-45	5	1
β-strand	48-49	2	1
β-strand	55	1	2
α-helix	57-59	3
β-strand	65-71	7	1

Chain B: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	324-326	3
α-helix	328-331	4
α-helix	333-342	10
α-helix	347-357	11
α-helix	361-370	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin	A	protein	76	Saccharomyces cerevisiae	P0CG63 (AlphaFold model)
Ubiquitin-like protein DSK2	B	protein	58	Saccharomyces cerevisiae	P48510 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1WR1_1 Ubiquitin (chains A)
MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGG

Sequence of entity 2 (B), FASTA

>1WR1_2 Ubiquitin-like protein DSK2 (chains B)
PGISGGGGGILDPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSLLNGDV

Primary citation

Structure of the UBA domain of Dsk2p in complex with ubiquitin molecular determinants for ubiquitin recognition. Ohno, A., Jee, J., Fujiwara, K. et al. Structure (2005) 13:521-532. DOI 10.1016/j.str.2005.01.011 · PubMed

Other PDB entries of the same protein (UniProt P0CG63 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4Q5E 1.87 Å, Shigella Effector Kinase OspG bound to E2-Ub UbcH7-Ub Conjugate
4Q5H 2.0 Å, Shigella Effector Kinase OspG bound to AMPPNP and E2-Ub UbcH7-Ub Conjugate
4NNJ 2.4 Å, Crystal structure of Uba1 in complex with ubiquitin-AMP and thioesterified ubiquitin
3OLM 2.5 Å, Structure and Function of a Ubiquitin Binding Site within the Catalytic Domain of a HECT…
4HCN 2.6 Å, Crystal structure of Burkholderia pseudomallei effector protein CHBP in complex with…
3CMM 2.7 Å, Crystal Structure of the Uba1-Ubiquitin Complex
9OFV 3.16 Å, Consensus reconstruction of the eukaryotic Ribosome-associated Quality Control complex
8DAV 3.5 Å, Saccharomyces cerevisiae Ufd1/Npl4/Cdc48 complex bound to two ubiquitin moieties and one…
8DAW 3.6 Å, Saccharomyces cerevisiae Ufd1/Npl4/Cdc48 complex bound to three ubiquitin moieties and…
8DAU 3.7 Å, Saccharomyces cerevisiae Ufd1/Npl4/Cdc48 complex bound to two folded ubiquitin moieties…
8DAT 3.8 Å, Saccharomyces cerevisiae Ufd1/Npl4/Cdc48 complex bound to three ubiquitin moieties in…
1OTR Solution Structure of a CUE-Ubiquitin Complex

Browse structure collections

About this viewer

MolViewer shows 1WR1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.