Crystal structure of the C-terminal domain of the end-binding protein 1 (EB1). Determined by X-ray diffraction at 1.54 Å resolution. Released 1 Feb 2005.
Explore 1WU9 in 3D Show helices and sheets RCSB PDB PDBe
1WU9 contains 6 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 192-230 | 39 | |
| α-helix | 237-247 | 11 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 192-230 | 39 | |
| α-helix | 237-246 | 10 | |
| α-helix | 247-249 | 3 | |
| α-helix | 251-253 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Microtubule-associated protein RP/EB family member 1 | A, B | protein | 80 | Homo sapiens | Q15691 (AlphaFold model) |
>1WU9_1 Microtubule-associated protein RP/EB family member 1 (chains A, B) GSDEAAELMQQVNVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQRIVDILYA TDEGFVIPDEGGPQEEQEEY
Structural insights into the EB1-APC interaction. Honnappa, S., John, C.M., Kostrewa, D. et al. EMBO J (2005) 24:261-269. DOI 10.1038/sj.emboj.7600529 · PubMed
Other PDB entries of the same protein (UniProt Q15691 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1WU9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.