1WWT: TGS domain from human threonyl-tRNA synthetase

Solution structure of the TGS domain from human threonyl-tRNA synthetase. Determined by solution NMR. Released 18 Jul 2005.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 656
Mol. weight: 9.37 kDa
Released: 18 Jul 2005

Explore 1WWT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1WWT contains 2 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	11-15	5	1
β-strand	21-25	5	1
α-helix	31-37	7
α-helix	43-45	3
β-strand	49-51	3	2
β-strand	55-56	2	2
β-strand	66-67	2	1
β-strand	68-70	3	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Threonyl-tRNA synthetase, cytoplasmic	A	protein	88	Homo sapiens	P26639 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1WWT_1 Threonyl-tRNA synthetase, cytoplasmic (chains A)
GSSGSSGDSKPIKVTLPDGKQVDAESWKTTPYQIACGISQGLADNTVIAKVNNVVWDLDR
PLEEDCTLELLKFEDEEAQAVYSGPSSG

Primary citation

Solution structure of the TGS domain from human threonyl-tRNA synthetase. Chikayama, E., Kigawa, T., Tomizawa, T. et al. To be published.

Other PDB entries of the same protein (UniProt P26639 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5XLN 1.9 Å, Crystal structure of the TRS_UNE-T and 4EHP complex
4HWT 2.3 Å, Crystal structure of human Threonyl-tRNA synthetase bound to a novel inhibitor
4P3N 2.6 Å, Structural Basis for Full-Spectrum Inhibition of Threonyl-tRNA Synthetase by Borrelidin 1
4TTV 2.8 Å, Crystal structure of human ThrRS complexing with a bioengineered macrolide BC194

Browse structure collections

About this viewer

MolViewer shows 1WWT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.