5XLN: TRS_UNE-T and 4EHP complex

Crystal structure of the TRS_UNE-T and 4EHP complex. Determined by X-ray diffraction at 1.9 Å resolution. Released 21 Nov 2018.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,754
Mol. weight: 27.05 kDa
Released: 21 Nov 2018

Explore 5XLN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5XLN contains 7 α-helices and 7 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	49-50	2
β-strand	55-66	12	1
β-strand	83-90	8	1
α-helix	91-98	8
α-helix	102-103	2
α-helix	104-106	3
β-strand	111-117	7	1
β-strand	133-140	8	1
α-helix	144-156	13
β-strand	166-173	8	1
β-strand	177-184	8	1
α-helix	190-204	15
β-strand	213-216	4	1

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	57-69	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Eukaryotic translation initiation factor 4E type 2	A	protein	190	Homo sapiens	O60573 (AlphaFold model)
Threonine--tRNA ligase, cytoplasmic	B	protein	45	Homo sapiens	P26639 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5XLN_1 Eukaryotic translation initiation factor 4E type 2 (chains A)
KAVVPGPAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRP
GDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGE
EICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKMP
GRLGPQRLLF

Sequence of entity 2 (B), FASTA

>5XLN_2 Threonine--tRNA ligase, cytoplasmic (chains B)
GGKKKNKEGSGDGGRAELNPWPEYIYTRLEMYNILKAEHDSILAE

Primary citation

A threonyl-tRNA synthetase-mediated translation initiation machinery. Jeong, S.J., Park, S., Nguyen, L.T. et al. Nat Commun (2019) 10:1357-1357. DOI 10.1038/s41467-019-09086-0 · PubMed

Other PDB entries of the same protein (UniProt O60573 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2JGB 1.7 Å, Structure of human eIF4E homologous protein 4EHP with m7GTP
5NVN 1.9 Å, Crystal structure of the human 4EHP-4E-BP1 complex
5NVM 2.0 Å, Crystal structure of the human 4EHP-GIGYF2 complex lacking the auxiliary sequences
5NVL 2.3 Å, Crystal structure of the human 4EHP-GIGYF2 complex
2JGC 2.4 Å, Structure of the human eIF4E homologous protein, 4EHP without ligand bound
5NVK 2.9 Å, Crystal structure of the human 4EHP-GIGYF1 complex

Browse structure collections

About this viewer

MolViewer shows 5XLN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.