1WXS: Ufm1, a ubiquitin-fold modifier

Solution Structure of Ufm1, a ubiquitin-fold modifier. Determined by solution NMR. Released 18 Apr 2006.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 658
Mol. weight: 9.54 kDa
Released: 18 Apr 2006

Explore 1WXS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1WXS contains 2 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	4-9	6	1
β-strand	20-23	4	1
β-strand	28	1	2
α-helix	29-39	11
β-strand	47-51	5	1
β-strand	62	1	2
α-helix	63-69	7
β-strand	73-78	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin-fold Modifier 1	A	protein	90	Homo sapiens	P61960 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1WXS_1 Ubiquitin-fold Modifier 1 (chains A)
GPLGSMSKVSFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGI
GINPAQTAGNVFLKHGSELRIIPRDRVGSC

Primary citation

Solution structure and dynamics of Ufm1, a ubiquitin-fold modifier 1. Sasakawa, H., Sakata, E., Yamaguchi, Y. et al. Biochem Biophys Res Commun (2006) 343:21-26. DOI 10.1016/j.bbrc.2006.02.107 · PubMed

Other PDB entries of the same protein (UniProt P61960 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7W3N 1.6 Å, Crystal structure of Ufm1 fused to UFBP1 UFIM
8BZR 1.78 Å, UFC1-UFM1 conjugate
5IAA 1.85 Å, Crystal structure of human UBA5 in complex with UFM1
5IA7 2.0 Å, Crystal structure of Ubiquitin fold modifier 1 (Ufm1)
5IA8 2.0 Å, Structure of a Ubiquitin like protein with an E1 fragment
5L95 2.1 Å, Crystal structure of human UBA5 in complex with UFM1 and AMP
6H77 2.1 Å, E1 enzyme for ubiquitin like protein activation in complex with UBL
5HKH 2.55 Å, Crystal structure of Ufm1 in complex with UBA5
8OJ5 2.9 Å, 60S ribosomal subunit bound to the E3-UFM1 complex - state 3 (in-vitro reconstitution)
9GY4 3.0 Å, 60S ribosomal subunit in complex with E3-UFM1 ligase and RQC machinery components NEMF…
8OHD 3.1 Å, 60S ribosomal subunit bound to the E3-UFM1 complex - state 3 (native)
8QFC 3.2 Å, UFL1 E3 ligase bound 60S ribosome

Browse structure collections

About this viewer

MolViewer shows 1WXS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.