1X4J: RING finger in RING finger protein 38

Solution structure of RING finger in RING finger protein 38. Determined by solution NMR. Released 14 Nov 2005.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 578
Mol. weight: 8.44 kDa
Ligands: ZN
Released: 14 Nov 2005

Explore 1X4J in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1X4J contains 3 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	9-11	3
β-strand	12-13	2	1
β-strand	14	1	2
β-strand	25-26	2	3
β-strand	31-32	2	3
α-helix	33-34	2
β-strand	35	1	2
β-strand	38-42	5	1
β-strand	46-49	4	1
α-helix	52-59	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RING finger protein 38	A	protein	75	Homo sapiens	Q9H0F5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1X4J_1 RING finger protein 38 (chains A)
GSSGSSGQLPSYRFNPNNHQSEQTLCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKAN
RTCPICRADSGPSSG

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

Solution structure of RING finger in RING finger protein 38. He, F., Muto, Y., Inoue, M. et al. To be published.

Other PDB entries of the same protein (UniProt Q9H0F5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9Q88 1.2 Å, High-resolution structure of RNF38 RING domain
4V3L 1.53 Å, RNF38-UB-UbcH5B-Ub complex
4V3K 2.04 Å, RNF38-UbcH5B-UB complex
7OJX 2.4 Å, E2 UBE2K covalently linked to donor Ub, acceptor di-Ub, and RING E3 primed for…
9Q8Y 2.63 Å, Structure of RNF38 RING with linchpin mutant R454Y in complex with Ubch5B-Ub

Browse structure collections

About this viewer

MolViewer shows 1X4J directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.