1X57: HTH domain of human EDF-1 protein

Solution structures of the HTH domain of human EDF-1 protein. Determined by solution NMR. Released 15 Nov 2005.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 670
Mol. weight: 9.57 kDa
Released: 15 Nov 2005

Explore 1X57 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1X57 contains 4 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	13-23	11
α-helix	29-36	8
α-helix	40-48	9
α-helix	55-65	11
β-strand	67	1	1
β-strand	77	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Endothelial differentiation-related factor 1	A	protein	91	Homo sapiens	O60869 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1X57_1 Endothelial differentiation-related factor 1 (chains A)
GSSGSSGDRVTLEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGK
IERAIGLKLRGKDIGKPIEKGPRAKSGPSSG

Primary citation

Solution structures of the HTH domain of human EDF-1 protein. Nameki, N., Sato, M., Tochio, N. et al. To be published.

Other PDB entries of the same protein (UniProt O60869 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9RPV 2.35 Å, Structure of the ZAK-bound human disome
9P73 2.66 Å, In situ human eEF2-A/P-P/E state 80S ribosome
6ZVH 2.9 Å, EDF1-ribosome complex
9P8H 2.98 Å, In situ human A/P-P/E state 80S ribosome
9B0Q 3.2 Å, In situ human top-back di-ribosome structure (Composite map)
9B0S 3.8 Å, In situ human top-top di-ribosome structure (Composite map)

Browse structure collections

About this viewer

MolViewer shows 1X57 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.