1X5M: Calcyclin-binding protein

Solution structure of the core domain of calcyclin binding protein; siah-interacting protein (SIP). Determined by solution NMR. Released 16 Nov 2005.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 988
Mol. weight: 14.08 kDa
Released: 16 Nov 2005

Explore 1X5M in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1X5M contains 1 α-helix and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 10 β-strands

Element	Residues	Length	Sheet
β-strand	18-19	2	1
β-strand	24-28	5	2
β-strand	31-37	7	2
β-strand	49-53	5	1
β-strand	57-62	6	1
β-strand	70-75	6	1
β-strand	77	1	3
β-strand	87-91	5	2
β-strand	94-100	7	2
β-strand	112	1	3
α-helix	113-119	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Calcyclin-binding protein	A	protein	127	Homo sapiens	Q9HB71 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1X5M_1 Calcyclin-binding protein (chains A)
GSSGSSGVVAPITTGYTVKISNYGWDQSDKFVKIYITLTGVHQVPTENVQVHFTERSFDL
LVKNLNGKSYSMIVNNLLKPISVEGSSKKVKTDTVLILCRKKVENTRWDYLTQVEKECKE
KSGPSSG

Primary citation

Solution structure of the core domain of calcyclin binding protein; siah-interacting protein (SIP). Qin, X.R., Nagashima, T., Hayashi, F. et al. To be published.

Other PDB entries of the same protein (UniProt Q9HB71 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2A26 1.2 Å, Crystal structure of the N-terminal, dimerization domain of Siah Interacting Protein
2A25 2.2 Å, Crystal structure of Siah1 SBD bound to the peptide EKPAAVVAPITTG from SIP

Browse structure collections

About this viewer

MolViewer shows 1X5M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.