1X5S: RRM domain in A18 hnRNP

Solution structure of RRM domain in A18 hnRNP. Determined by solution NMR. Released 16 Nov 2005.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 758
Mol. weight: 10.86 kDa
Released: 16 Nov 2005

Explore 1X5S in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1X5S contains 2 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	14-18	5	1
α-helix	26-36	11
β-strand	41-44	4	1
β-strand	56-60	5	1
α-helix	64-74	11
β-strand	85-90	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cold-inducible RNA-binding protein	A	protein	102	Homo sapiens	Q14011 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1X5S_1 Cold-inducible RNA-binding protein (chains A)
GSSGSSGMASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVT
FENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSGPSSG

Primary citation

Solution structure of RRM domain in A18 hnRNP. Sato, A., Muto, Y., Inoue, M. et al. To be published.

Other PDB entries of the same protein (UniProt Q14011 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5TBX 1.77 Å, hnRNP A18 RNA Recognition Motif
8CMK 2.94 Å, Transportin-3 TNPO3 in complex with RSY region of CIRBP

Browse structure collections

About this viewer

MolViewer shows 1X5S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.