5TBX: HnRNP A18 RNA Recognition Motif

hnRNP A18 RNA Recognition Motif. Determined by X-ray diffraction at 1.77 Å resolution. Released 12 Apr 2017.

Method: X-ray diffraction
Resolution: 1.77 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,478
Mol. weight: 20.46 kDa
Ligands: NI
Released: 12 Apr 2017

Explore 5TBX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5TBX contains 6 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	8-12	5	1
α-helix	20-27	8
α-helix	28-30	3
β-strand	33-40	8	1
β-strand	47-55	9	1
α-helix	58-68	11
β-strand	72-73	2	2
β-strand	76-77	2	2
β-strand	79-82	4	1

Chain B: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	4-12	9	3
α-helix	20-27	8
α-helix	28-30	3
β-strand	33-40	8	3
β-strand	47-55	9	3
α-helix	58-68	11
β-strand	72-73	2	4
β-strand	76-77	2	4
β-strand	79-84	6	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cold-inducible RNA-binding protein	A, B	protein	92	Homo sapiens	Q14011 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5TBX_1 Cold-inducible RNA-binding protein (chains A, B)
GMASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDD
AKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSR

Ligands and cofactors

ID	Name	Formula	Copies
NI	Nickel (II) ion	Ni	1

Water and common crystallization additives (ACT) are not listed.

Primary citation

Crystal structure of the human heterogeneous ribonucleoprotein A18 RNA-recognition motif. Coburn, K., Melville, Z., Aligholizadeh, E. et al. Acta Crystallogr F Struct Biol Commun (2017) 73:209-214. DOI 10.1107/S2053230X17003454 · PubMed

Other PDB entries of the same protein (UniProt Q14011 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8CMK 2.94 Å, Transportin-3 TNPO3 in complex with RSY region of CIRBP
1X5S Solution structure of RRM domain in A18 hnRNP

Browse structure collections

About this viewer

MolViewer shows 5TBX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.