1X6H: Transcriptional repressor CTCF

Solution structures of the C2H2 type zinc finger domain of human Transcriptional repressor CTCF. Determined by solution NMR. Released 17 Nov 2005.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 652
Mol. weight: 9.47 kDa
Ligands: ZN
Released: 17 Nov 2005

Explore 1X6H in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1X6H contains 3 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	16-17	2	1
β-strand	24-25	2	1
α-helix	28-34	7
α-helix	35-39	5
β-strand	48-49	2	2
β-strand	56-57	2	2
α-helix	60-69	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcriptional repressor CTCF	A	protein	86	Homo sapiens	P49711 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1X6H_1 Transcriptional repressor CTCF (chains A)
GSSGSSGRTHTGEKPYACSHCDKTFRQKQLLDMHFKRYHDPNFVPAAFVCSKCGKTFTRR
NTMARHADNCAGPDGVEGENSGPSSG

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

Solution structures of the C2H2 type zinc finger domain of human Transcriptional repressor CTCF. Sato, M., Saito, K., Koshiba, S. et al. To be published.

Other PDB entries of the same protein (UniProt P49711 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5KKQ 1.74 Å, Homo sapiens CCCTC-binding factor (CTCF) ZnF3-7 and DNA complex structure
5YEG 2.0 Å, Crystal structure of CTCF ZFs4-8-Hs5-1a complex
5K5I 2.19 Å, Homo sapiens CCCTC-binding factor (CTCF) ZnF5-8 and DNA complex structure in space group…
5T00 2.19 Å, Human CTCF ZnF3-7 and methylated DNA complex
8SST 2.19 Å, ZnFs 1-7 of CCCTC-binding factor (CTCF) K365T Mutant Complexed with 23mer
5K5J 2.29 Å, Homo sapiens CCCTC-binding factor (CTCF) ZnF5-8 and DNA complex structure in space group…
8SSS 2.3 Å, ZnFs 1-7 of CCCTC-binding factor (CTCF) Complexed with 23mer
5YEH 2.33 Å, Crystal structure of CTCF ZFs4-8-eCBS
5UND 2.55 Å, Crystal Structure of CTCF(ZnF 4-10) With 28-mer DNA
6QNX 2.7 Å, Structure of the SA2/SCC1/CTCF complex
5YEF 2.81 Å, Crystal structure of CTCF ZFs2-8-Hs5-1aE
8SSU 2.89 Å, ZnFs 3-11 of CCCTC-binding factor (CTCF) Complexed with 19mer DNA

Browse structure collections

About this viewer

MolViewer shows 1X6H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.