1XB0: BIR domain of IAP-like protein 2

Structure of the BIR domain of IAP-like protein 2. Determined by X-ray diffraction at 2.2 Å resolution. Released 2 Nov 2004.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 12
Atoms: 5,158
Mol. weight: 80.03 kDa
Ligands: ZN
Released: 2 Nov 2004

Explore 1XB0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1XB0 contains 41 α-helices and 24 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C, D and E: 7 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	260-262	3
α-helix	265-269	5
α-helix	270-272	3
α-helix	281-286	6
β-strand	289-291	3	1
β-strand	298-300	3	1
β-strand	306-308	3	1
α-helix	316-323	8
α-helix	328-334	7
α-helix	336-342	7

Chain F: 6 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	260-262	3
α-helix	265-269	5
α-helix	270-272	3
α-helix	281-286	6
β-strand	289-291	3	6
β-strand	298-300	3	6
β-strand	306-308	3	6
α-helix	316-323	8
α-helix	328-342	15

Chains G, H, I, J, K and L: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	902-903	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Baculoviral IAP repeat-containing protein 8	A, B, C, D, E, F	protein	108	Homo sapiens	Q96P09 (AlphaFold model)
Diablo homolog, mitochondrial	G, H, I, J, K, L	protein	7		Q9NR28 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F), FASTA

>1XB0_1 Baculoviral IAP repeat-containing protein 8 (chains A, B, C, D, E, F)
GSHMSTNLPRNPSMTGYEARLITFGTWMYSVNKEQLARAGFYAIGQEDKVQCFHCGGGLA
NWKPKEDPWEQHAKWYPGCKYLLEEKGHEYINNIHLTRSLEGALVQTT

Sequence of entity 2 (G, H, I, J, K, L), FASTA

>1XB0_2 Diablo homolog, mitochondrial (chains G, H, I, J, K, L)
AVPIAQK

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	24

Primary citation

The BIR domain of IAP-like protein 2 is conformationally unstable: implications for caspase inhibition. Shin, H., Renatus, M., Eckelman, B.P. et al. Biochem J (2005) 385:1-10. DOI 10.1042/BJ20041107 · PubMed

Other PDB entries of the same protein (UniProt Q96P09 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1XB1 2.7 Å, The Structure of the BIR domain of IAP-like protein 2

Browse structure collections

About this viewer

MolViewer shows 1XB0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.