1XB1: BIR domain of IAP-like protein 2
The Structure of the BIR domain of IAP-like protein 2. Determined by X-ray diffraction at 2.7 Å resolution. Released 2 Nov 2004.
- Method
- X-ray diffraction
- Resolution
- 2.7 Å
- Organism
- Homo sapiens
- Chains
- 12
- Atoms
- 5,005
- Mol. weight
- 79.97 kDa
- Ligands
- ZN
- Released
- 2 Nov 2004
Explore 1XB1 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
1XB1 contains 40 α-helices and 26 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 7 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 260-262 | 3 | |
| α-helix | 265-269 | 5 | |
| α-helix | 270-272 | 3 | |
| α-helix | 281-286 | 6 | |
| β-strand | 289-291 | 3 | 1 |
| β-strand | 298-300 | 3 | 1 |
| β-strand | 306-308 | 3 | 1 |
| α-helix | 316-323 | 8 | |
| α-helix | 328-334 | 7 | |
| α-helix | 336-341 | 6 | |
Chain B: 6 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 260-262 | 3 | |
| α-helix | 265-269 | 5 | |
| α-helix | 281-286 | 6 | |
| β-strand | 289-291 | 3 | 2 |
| β-strand | 298-300 | 3 | 2 |
| β-strand | 306-308 | 3 | 2 |
| α-helix | 316-323 | 8 | |
| α-helix | 328-333 | 6 | |
| α-helix | 336-342 | 7 | |
Chain C: 7 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 260-262 | 3 | |
| α-helix | 265-269 | 5 | |
| α-helix | 270-272 | 3 | |
| α-helix | 281-286 | 6 | |
| β-strand | 289-291 | 3 | 3 |
| β-strand | 298-300 | 3 | 3 |
| β-strand | 306-308 | 3 | 3 |
| α-helix | 316-323 | 8 | |
| α-helix | 328-333 | 6 | |
| α-helix | 336-342 | 7 | |
Chain D: 7 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 260-262 | 3 | |
| α-helix | 265-269 | 5 | |
| α-helix | 270-272 | 3 | |
| α-helix | 281-286 | 6 | |
| β-strand | 289-294 | 6 | 4 |
| β-strand | 297-300 | 4 | 4 |
| β-strand | 306-308 | 3 | 4 |
| α-helix | 310-311 | 2 | |
| α-helix | 316-323 | 8 | |
| α-helix | 328-342 | 15 | |
Chain E: 6 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 260-262 | 3 | |
| α-helix | 265-269 | 5 | |
| α-helix | 281-286 | 6 | |
| β-strand | 289-291 | 3 | 5 |
| β-strand | 294 | 1 | 6 |
| β-strand | 296 | 1 | 6 |
| β-strand | 298-300 | 3 | 5 |
| β-strand | 306-308 | 3 | 5 |
| α-helix | 316-323 | 8 | |
| α-helix | 328-334 | 7 | |
| α-helix | 336-342 | 7 | |
Chain F: 7 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 260-263 | 4 | |
| α-helix | 265-269 | 5 | |
| α-helix | 281-286 | 6 | |
| β-strand | 289-291 | 3 | 7 |
| β-strand | 298-300 | 3 | 7 |
| β-strand | 306-308 | 3 | 7 |
| α-helix | 310-311 | 2 | |
| α-helix | 316-323 | 8 | |
| α-helix | 328-333 | 6 | |
| α-helix | 335-342 | 8 | |
Chains G, H, I, J, K and L: 0 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| β-strand | 902-903 | 2 | 1 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Baculoviral IAP repeat-containing protein 8 | A, B, C, D, E, F | protein | 108 | Homo sapiens | Q96P09 (AlphaFold model) |
| Diablo homolog, mitochondrial | G, H, I, J, K, L | protein | 7 | | Q9NR28 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D, E, F), FASTA
>1XB1_1 Baculoviral IAP repeat-containing protein 8 (chains A, B, C, D, E, F)
GSHMSTNLPRNPSMTGYEARLITFGTWMYSVNKEQLARAGFYAIGQEDKVQCFHCGGGLA
NWKPKEDPWEQHAKWYPGCKYLLEEKGHEYINNIHLTRSLEGALVQTT
Sequence of entity 2 (G, H, I, J, K, L), FASTA
>1XB1_2 Diablo homolog, mitochondrial (chains G, H, I, J, K, L)
AVPIAQK
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| ZN | Zinc ion | Zn | 23 |
Primary citation
The BIR domain of IAP-like protein 2 is conformationally unstable: implications for caspase inhibition. Shin, H., Renatus, M., Eckelman, B.P. et al. Biochem J (2005) 385:1-10. DOI 10.1042/BJ20041107 · PubMed
Other PDB entries of the same protein (UniProt Q96P09 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 1XB0 2.2 Å, Structure of the BIR domain of IAP-like protein 2
Browse structure collections
About this viewer
MolViewer shows 1XB1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.