Solution structure of the Chemotaxis Inhibitory Protein of Staphylococcus aureus. Determined by solution NMR. Released 27 Sept 2005.
Explore 1XEE in 3D Show helices and sheets RCSB PDB PDBe
1XEE contains 4 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 37 | 1 | 1 |
| α-helix | 38-50 | 13 | |
| α-helix | 56-58 | 3 | |
| β-strand | 59-66 | 8 | 2 |
| β-strand | 71-75 | 5 | 2 |
| α-helix | 79-81 | 3 | |
| α-helix | 82-85 | 4 | |
| β-strand | 88 | 1 | 1 |
| β-strand | 93-100 | 8 | 2 |
| β-strand | 108-111 | 4 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| chemotaxis-inhibiting protein CHIPS | A | protein | 91 | Staphylococcus aureus | A6QIG7 (AlphaFold model) |
>1XEE_1 chemotaxis-inhibiting protein CHIPS (chains A) NSGLPTTLGKLDERLRNYLKKGTKNSAQFEKMVILTENKGYYTVYLNTPLAEDRKNVELL GKMYKTYFFKKGESKSSYVINGPGKTNEYAY
The structure of the C5a receptor-blocking domain of chemotaxis inhibitory protein of Staphylococcus aureus is related to a group of immune evasive molecules. Haas, P.J., de Haas, C.J., Poppelier, M.J. et al. J Mol Biol (2005) 353:859-872. DOI 10.1016/j.jmb.2005.09.014 · PubMed
Other PDB entries of the same protein (UniProt A6QIG7 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1XEE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.