1XFY: Anthrax edema factor

Crystal structure of anthrax edema factor (EF) in complex with calmodulin. Determined by X-ray diffraction at 3.3 Å resolution. Released 3 May 2005.

Method: X-ray diffraction
Resolution: 3.3 Å
Organisms: Bacillus anthracis, Homo sapiens
Chains: 12
Atoms: 42,846
Mol. weight: 642.51 kDa
Ligands: CA, MG
Released: 3 May 2005

Explore 1XFY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1XFY contains 246 α-helices and 218 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and F: 33 helices, 33 β-strands

Element	Residues	Length	Sheet
β-strand	67-69	3	1
α-helix	76-88	13
α-helix	91-97	7
β-strand	103-107	5	1
α-helix	137-139	3
β-strand	142-145	4	1
β-strand	151-155	5	1
α-helix	170-176	7
α-helix	180-182	3
β-strand	186	1	2
β-strand	190	1	2
α-helix	192-197	6
α-helix	236-249	14
α-helix	255-260	6
α-helix	264-270	7
α-helix	271-275	5
α-helix	276-290	15
α-helix	309-321	13
β-strand	324-328	5	3
α-helix	333-335	3
α-helix	336-340	5
β-strand	344-345	2	4
β-strand	365	1	5
α-helix	368-370	3
α-helix	377-392	16
β-strand	398-402	5	5
β-strand	404	1	6
α-helix	407-415	9
β-strand	420-421	2	7
β-strand	425-426	2	8
β-strand	431-432	2	8
β-strand	435-436	2	7
β-strand	442-446	5	9
β-strand	452	1	6
β-strand	453-457	5	9
β-strand	463	1	10
β-strand	467	1	10
β-strand	472-473	2	9
β-strand	475-479	5	5
β-strand	486-487	2	5
β-strand	488-489	2	4
β-strand	494-499	6	3
β-strand	500	1	11
α-helix	501-505	5
α-helix	510-517	8
α-helix	522-533	12
α-helix	534-538	5
β-strand	541-543	3	12
β-strand	547-549	3	12
α-helix	551-561	11
α-helix	580-582	3
β-strand	594-596	3	3
β-strand	602-604	3	3
α-helix	608-614	7
α-helix	615-620	6
β-strand	624	1	11
β-strand	636	1	13
β-strand	641	1	13
α-helix	648-651	4
α-helix	660-671	12
α-helix	687-704	18
α-helix	708-711	4
α-helix	714-736	23
α-helix	743-764	22
α-helix	773-778	6
α-helix	787-796	10

Chain B: 33 helices, 33 β-strands

Element	Residues	Length	Sheet
β-strand	67-69	3	14
α-helix	76-88	13
α-helix	91-97	7
β-strand	103-107	5	14
α-helix	137-139	3
β-strand	142-145	4	14
β-strand	151-155	5	14
α-helix	170-176	7
α-helix	180-182	3
β-strand	186	1	15
β-strand	190	1	15
α-helix	192-197	6
α-helix	236-249	14
α-helix	255-260	6
α-helix	264-270	7
α-helix	271-275	5
α-helix	276-290	15
α-helix	309-321	13
β-strand	324-328	5	16
α-helix	333-335	3
α-helix	336-340	5
β-strand	344-345	2	17
β-strand	365	1	18
α-helix	368-370	3
α-helix	377-392	16
β-strand	398-402	5	18
β-strand	404	1	19
α-helix	407-415	9
β-strand	420-421	2	20
β-strand	425-426	2	21
β-strand	431-432	2	21
β-strand	435-436	2	20
β-strand	442-446	5	22
β-strand	452	1	19
β-strand	453-457	5	22
β-strand	463	1	23
β-strand	467	1	23
β-strand	472-473	2	22
β-strand	475-479	5	18
β-strand	486-487	2	18
β-strand	488-489	2	17
β-strand	494-499	6	16
β-strand	500	1	24
α-helix	501-505	5
α-helix	510-517	8
α-helix	522-533	12
α-helix	534-538	5
β-strand	541-543	3	25
β-strand	547-549	3	25
α-helix	551-561	11
α-helix	580-582	3
β-strand	594-596	3	16
β-strand	602-604	3	16
α-helix	608-614	7
α-helix	615-620	6
β-strand	624	1	24
β-strand	636	1	26
β-strand	641	1	26
α-helix	648-651	4
α-helix	660-671	12
α-helix	687-704	18
α-helix	708-711	4
α-helix	714-735	22
α-helix	743-764	22
α-helix	773-778	6
α-helix	787-796	10

Chains C and D: 33 helices, 31 β-strands

Element	Residues	Length	Sheet
β-strand	67-69	3	27
α-helix	76-88	13
α-helix	91-97	7
β-strand	103-107	5	27
α-helix	137-139	3
β-strand	142-145	4	27
β-strand	151-155	5	27
α-helix	170-176	7
α-helix	180-182	3
α-helix	192-197	6
α-helix	236-249	14
α-helix	255-260	6
α-helix	264-270	7
α-helix	271-275	5
α-helix	276-290	15
α-helix	309-321	13
β-strand	324-328	5	28
α-helix	333-335	3
α-helix	336-340	5
β-strand	344-345	2	29
β-strand	365	1	30
α-helix	368-370	3
α-helix	377-392	16
β-strand	398-402	5	30
β-strand	404	1	31
α-helix	407-415	9
β-strand	420-421	2	32
β-strand	425-426	2	33
β-strand	431-432	2	33
β-strand	435-436	2	32
β-strand	442-446	5	34
β-strand	452	1	31
β-strand	453-457	5	34
β-strand	463	1	35
β-strand	467	1	35
β-strand	472-473	2	34
β-strand	475-479	5	30
β-strand	486-487	2	30
β-strand	488-489	2	29
β-strand	494-499	6	28
β-strand	500	1	36
α-helix	501-505	5
α-helix	510-517	8
α-helix	522-533	12
α-helix	534-538	5
β-strand	541-543	3	37
β-strand	547-549	3	37
α-helix	551-561	11
α-helix	580-582	3
β-strand	594-596	3	28
β-strand	602-604	3	28
α-helix	608-614	7
α-helix	615-620	6
β-strand	624	1	36
β-strand	636	1	38
β-strand	641	1	38
α-helix	648-651	4
α-helix	660-671	12
α-helix	687-704	18
α-helix	708-711	4
α-helix	714-736	23
α-helix	743-764	22
α-helix	773-778	6
α-helix	787-796	10

Chain E: 33 helices, 33 β-strands

Element	Residues	Length	Sheet
β-strand	67-69	3	51
α-helix	76-88	13
α-helix	91-97	7
β-strand	103-107	5	51
α-helix	137-139	3
β-strand	142-144	3	51
β-strand	151-155	5	51
α-helix	170-176	7
α-helix	180-182	3
β-strand	186	1	52
β-strand	190	1	52
α-helix	192-197	6
α-helix	236-249	14
α-helix	255-260	6
α-helix	264-270	7
α-helix	271-275	5
α-helix	276-290	15
α-helix	309-321	13
β-strand	324-328	5	53
α-helix	333-335	3
α-helix	336-340	5
β-strand	344-345	2	54
β-strand	365	1	55
α-helix	368-370	3
α-helix	377-392	16
β-strand	398-402	5	55
β-strand	404	1	56
α-helix	407-415	9
β-strand	420-421	2	57
β-strand	425-426	2	58
β-strand	431-432	2	58
β-strand	435-436	2	57
β-strand	442-446	5	59
β-strand	452	1	56
β-strand	453-457	5	59
β-strand	463	1	60
β-strand	467	1	60
β-strand	472-473	2	59
β-strand	475-479	5	55
β-strand	486-487	2	55
β-strand	488-489	2	54
β-strand	494-499	6	53
β-strand	500	1	61
α-helix	501-505	5
α-helix	510-517	8
α-helix	522-533	12
α-helix	534-538	5
β-strand	541-543	3	62
β-strand	547-549	3	62
α-helix	551-561	11
α-helix	580-582	3
β-strand	594-596	3	53
β-strand	602-604	3	53
α-helix	608-614	7
α-helix	615-620	6
β-strand	624	1	61
β-strand	636	1	63
β-strand	641	1	63
α-helix	648-651	4
α-helix	660-671	12
α-helix	687-704	18
α-helix	708-711	4
α-helix	714-736	23
α-helix	743-764	22
α-helix	773-778	6
α-helix	787-796	10

Chains O, P, Q, R, S and T: 8 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	7-16	10
β-strand	26-28	3	77
α-helix	29-39	11
α-helix	47-54	8
β-strand	62-64	3	77
α-helix	65-75	11
α-helix	82-92	11
β-strand	99-100	2	78
α-helix	102-109	8
α-helix	118-128	11
β-strand	136-137	2	78
α-helix	138-146	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Calmodulin-sensitive adenylate cyclase	A, B, C, D, E, F	protein	777	Bacillus anthracis	P40136 (AlphaFold model)
Calmodulin 2	O, P, Q, R, S, T	protein	149	Homo sapiens	P0DP23 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F), FASTA

>1XFY_1 Calmodulin-sensitive adenylate cyclase (chains A, B, C, D, E, F)
MHHHHHHAAAMNEHYTESDIKRNHKTEKNKTEKEKFKDSINNLVKTEFTNETLDKIQQTQ
DLLKKIPKDVLEIYSELGGEIYFTDIDLVEHKELQDLSEEEKNSMNSRGEKVPFASRFVF
EKKRETPKLIINIKDYAINSEQSKEVYYEIGKGISLDIISKDKSLDPEFLNLIKSLSDDS
DSSDLLFSQKFKEKLELNNKSIDINFIKENLTEFQHAFSLAFSYYFAPDHRTVLELYAPD
MFEYMNKLEKGGFEKISESLKKEGVEKDRIDVLKGEKALKASGLVPEHADAFKKIARELN
TYILFRPVNKLATNLIKSGVATKGLNVHGKSSDWGPVAGYIPFDQDLSKKHGQQLAVEKG
NLENKKSITEHEGEIGKIPLKLDHLRIEELKENGIILKGKKEIDNGKKYYLLESNNQVYE
FRISDENNEVQYKTKEGKITVLGEKFNWRNIEVMAKNVEGVLKPLTADYDLFALAPSLTE
IKKQIPQKEWDKVVNTPNSLEKQKGVTNLLIKYGIERKPDSTKGTLSNWQKQMLDRLNEA
VKYTGYTGGDVVNHGTEQDNEEFPEKDNEIFIINPEGEFILTKNWEMTGRFIEKNITGKD
YLYYFNRSYNKIAPGNKAYIEWTDPITKAKINTIPTSAEFIKNLSSIRRSSNVGVYKDSG
DKDEFAKKESVKKIAGYLSDYYNSANHIFSQEKKRKISIFRGIQAYNEIENVLKSKQIAP
EYKNYFQYLKERITNQVQLLLTHQKSNIEFKLLYKQLNFTENETDNFEVFQKIIDEK

Sequence of entity 2 (O, P, Q, R, S, T), FASTA

>1XFY_2 Calmodulin 2 (chains O, P, Q, R, S, T)
MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG
NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDE
EVDQMIREADIDGDGQVNYEEFVQMMTAK

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	12
MG	Magnesium ion	Mg	6

Primary citation

Calcium-independent calmodulin binding and two-metal-ion catalytic mechanism of anthrax edema factor. Shen, Y., Zhukovskaya, N.L., Guo, Q. et al. EMBO J (2005) 24:929-941. DOI 10.1038/sj.emboj.7600574 · PubMed

Other PDB entries of the same protein (UniProt P40136 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1K8T 2.6 Å, Crystal structure of the adenylyl cyclase domain of anthrax edema factor (EF)
1K90 2.75 Å, Crystal structure of the adenylyl cyclase domain of anthrax edema factor (EF) in complex…
1K93 2.95 Å, Crystal structure of the adenylyl cyclase domain of anthrax edema factor (EF) in complex…
1S26 3.0 Å, Structure of Anthrax Edema Factor-Calmodulin-alpha,beta-methyleneadenosine…
1SK6 3.2 Å, Crystal structure of the adenylyl cyclase domain of anthrax edema factor (EF) in complex…
1XFX 3.2 Å, Crystal structure of anthrax edema factor (EF) in complex with calmodulin in the…
6UZB 3.2 Å, Anthrax toxin protective antigen channels bound to edema factor
1XFZ 3.25 Å, Crystal structure of anthrax edema factor (EF) in complex with calmodulin in the…
1PK0 3.3 Å, Crystal Structure of the EF3-CaM complexed with PMEApp
6VRA 3.3 Å, Anthrax octamer prechannel bound to full-length edema factor
1XFU 3.35 Å, Crystal structure of anthrax edema factor (EF) truncation mutant, EF-delta 64 in complex…
1XFV 3.35 Å, Crystal structure of anthrax edema factor (EF) in complex with calmodulin and 3' deoxy-ATP

Browse structure collections

About this viewer

MolViewer shows 1XFY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.