1XK5: M3G-cap-binding domain of snurportin1

Crystal structure of the m3G-cap-binding domain of snurportin1 in complex with a m3GpppG-cap dinucleotide. Determined by X-ray diffraction at 2.4 Å resolution. Released 7 Jun 2005.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,765
Mol. weight: 23.98 kDa
Ligands: TPG
Released: 7 Jun 2005

Explore 1XK5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1XK5 contains 10 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	103-107	5	1
α-helix	111-112	2
α-helix	115-118	4
β-strand	119-125	7	1
β-strand	128-135	8	2
β-strand	138-142	5	2
β-strand	148-152	5	2
β-strand	170-177	8	2
α-helix	178-180	3
β-strand	182-191	10	2
β-strand	194-195	2	2
α-helix	201-211	11
β-strand	222	1	3
β-strand	225	1	3
β-strand	228-231	4	2
α-helix	232-233	2
β-strand	234-236	3	1
α-helix	239-246	8
β-strand	254-261	8	1
β-strand	269-277	9	1
α-helix	279-281	3
α-helix	282-286	5
α-helix	294-296	3
α-helix	297-299	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
snurportin-1	A	protein	204	Homo sapiens	O95149 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1XK5_1 snurportin-1 (chains A)
HYANQLMLSEWLIDVPSDLGQEWIVVVCPVGKRALIVASRGSTSAYTKSGYCVNRFSSLL
PGGNRRNSTAKDYTILDCIYNEVNQTYYVLDVMCWRGHPFYDCQTDFRFYWMHSKLPEEE
GLGEKTKLNPFKFVGLKNFPCTPESLCDVLSMDFPFEVDGLLFYHKQTHYSPGSTPLVGW
LRPYMVSDVLGVAVPAGPLTTKPD

Ligands and cofactors

ID	Name	Formula	Copies
TPG	2,2,7-trimethyl-guanosine-5'-triphosphate-5'-guanosine	C23 H35 N10 O18 P3	1

Primary citation

Structural basis for m(3)G-cap-mediated nuclear import of spliceosomal UsnRNPs by snurportin1. Strasser, A., Dickmanns, A., Luehrmann, R. et al. EMBO J (2005) 24:2235-2243. DOI 10.1038/sj.emboj.7600701 · PubMed

Other PDB entries of the same protein (UniProt O95149 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2P8Q 2.35 Å, Crystal Structure of human Importin beta bound to the Snurportin1 IBB-domain
3GJX 2.5 Å, Crystal Structure of the Nuclear Export Complex CRM1-Snurportin1-RanGTP
3NBZ 2.8 Å, Crystal structure of the HIV-1 Rev NES-CRM1-RanGTP nuclear export complex (crystal I)
2QNA 2.84 Å, Crystal structure of human Importin-beta (127-876) in complex with the IBB-domain of…
5DIS 2.85 Å, Crystal structure of a CRM1-RanGTP-SPN1 export complex bound to a 113 amino acid…
3GB8 2.9 Å, Crystal structure of CRM1/Snurportin-1 complex
3NC0 2.9 Å, Crystal structure of the HIV-1 Rev NES-CRM1-RanGTP nuclear export complex (crystal II)
3LWW 3.15 Å, Structure of an open and closed conformation of Human Importin Beta bound to the…
2Q5D 3.2 Å, Crystal Structure of Human Importin Beta bound to the Snurportin1 IBB-domain second…
3NBY 3.42 Å, Crystal structure of the PKI NES-CRM1-RanGTP nuclear export complex

Browse structure collections

About this viewer

MolViewer shows 1XK5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.