2QNA: Human Importin-beta

Crystal structure of human Importin-beta (127-876) in complex with the IBB-domain of Snurportin1 (1-65). Determined by X-ray diffraction at 2.84 Å resolution. Released 8 Apr 2008.

Method: X-ray diffraction
Resolution: 2.84 Å
Organism: Homo sapiens
Chains: 2
Atoms: 6,090
Mol. weight: 92.44 kDa
Released: 8 Apr 2008

Explore 2QNA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2QNA contains 48 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 47 helices, 0 β-strands

Element	Residues	Length
α-helix	129-138	10
α-helix	144-158	15
α-helix	163-181	19
α-helix	188-201	14
α-helix	202-204	3
α-helix	206-210	5
α-helix	212-225	14
α-helix	231-247	17
α-helix	254-256	3
α-helix	257-268	12
α-helix	273-303	31
α-helix	314-329	16
α-helix	344-359	16
α-helix	360-363	4
α-helix	364-374	11
α-helix	380-392	13
α-helix	399-417	19
α-helix	422-438	17
α-helix	440-443	4
α-helix	449-459	11
α-helix	464-484	21
α-helix	500-514	15
α-helix	521-523	3
α-helix	524-537	14
α-helix	541-543	3
α-helix	544-556	13
α-helix	558-562	5
α-helix	579-594	16
α-helix	597-617	21
α-helix	622-639	18
α-helix	640-646	7
α-helix	647-659	13
α-helix	664-681	18
α-helix	682-685	4
α-helix	686-701	16
α-helix	709-724	16
α-helix	725-728	4
α-helix	729-743	15
α-helix	752-777	26
α-helix	783-784	2
α-helix	785-789	5
α-helix	791-793	3
α-helix	794-806	13
α-helix	812-829	18
α-helix	831-838	8
α-helix	841-851	11
α-helix	856-874	19

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	38-63	26

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Importin subunit beta-1	A	protein	762	Homo sapiens	Q14974 (AlphaFold model)
Snurportin-1	B	protein	66	Homo sapiens	O95149 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2QNA_1 Importin subunit beta-1 (chains A)
SPELIPQLVANVTNPNSTEHMKESTLEAIGYICQDIDPEQLQDKSNEILTAIIQGMRKEE
PSNNVKLAATNALLNSLEFTKANFDKESERHFIMQVVCEATQCPDTRVRVAALQNLVKIM
SLYYQYMETYMGPALFAITIEAMKSDIDEVALQGIEFWSNVCDEEMDLAIEASEAAEQGR
PPEHTSKFYAKGALQYLVPILTQTLTKQDENDDDDDWNPCKAAGVCLMLLATCCEDDIVP
HVLPFIKEHIKNPDWRYRDAAVMAFGCILEGPEPSQLKPLVIQAMPTLIELMKDPSVVVR
DTAAWTVGRICELLPEAAINDVYLAPLLQCLIEGLSAEPRVASNVCWAFSSLAEAAYEAA
DVADDQEEPATYCLSSSFELIVQKLLETTDRPDGHQNNLRSSAYESLMEIVKNSAKDCYP
AVQKTTLVIMERLQQVLQMESHIQSTSDRIQFNDLQSLLCATLQNVLRKVQHQDALQISD
VVMASLLRMFQSTAGSGGVQEDALMAVSTLVEVLGGEFLKYMEAFKPFLGIGLKNYAEYQ
VCLAAVGLVGDLCRALQSNIIPFCDEVMQLLLENLGNENVHRSVKPQILSVFGDIALAIG
GEFKKYLEVVLNTLQQASQAQVDKSDYDMVDYLNELRESCLEAYTGIVQGLKGDQENVHP
DVMLVQPRVEFILSFIDHIAGDEDHTDGVVACAAGLIGDLCTAFGKDVLKLVEARPMIHE
LLTEGRRSKTNKAKTLATWATKELRKLKNQGLTRVDSSGRIV

Sequence of entity 2 (B), FASTA

>2QNA_2 Snurportin-1 (chains B)
MEELSQALASSFSVSQDLNSTAAPHPRLSQYKSKYSSLEQSERRRRLLELQKSKRLDYVN
HARRLA

Primary citation

Structural basis for RanGTP independent entry of spliceosomal U snRNPs into the nucleus. Wohlwend, D., Strasser, A., Dickmanns, A. et al. J Mol Biol (2007) 374:1129-1138. DOI 10.1016/j.jmb.2007.09.065 · PubMed

Other PDB entries of the same protein (UniProt Q14974 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1IBR 2.3 Å, Complex of ran with importin beta
1QGR 2.3 Å, Structure of importin beta bound to the ibb domain of importin alpha (II crystal form,…
2P8Q 2.35 Å, Crystal Structure of human Importin beta bound to the Snurportin1 IBB-domain
1QGK 2.5 Å, Structure of importin beta bound to the ibb domain of importin alpha
3W5K 2.6 Å, Crystal structure of Snail1 and importin beta complex
9N85 2.6 Å, Cryo-EM structure of human importin beta:Ran-GTP:RanBP1 trimeric complex
1F59 2.8 Å, Importin-beta-fxfg nucleoporin complex
1O6O 2.8 Å, Importin Beta aa1-442 bound to five FxFG repeats from yeast Nsp1p. Second crystal form
1O6P 2.8 Å, Importin Beta bound to a GLFG Nucleoporin peptide
1M5N 2.9 Å, Crystal structure of HEAT repeats (1-11) of importin b bound to the non-classical…
3LWW 3.15 Å, Structure of an open and closed conformation of Human Importin Beta bound to the…
2Q5D 3.2 Å, Crystal Structure of Human Importin Beta bound to the Snurportin1 IBB-domain second…

Browse structure collections

About this viewer

MolViewer shows 2QNA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.