1XKI: Human tear lipocalin/von Ebners gland protein

Crystal structure of human tear lipocalin/von Ebners gland protein. Determined by X-ray diffraction at 1.8 Å resolution. Released 19 Oct 2004.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,133
Mol. weight: 18.22 kDa
Ligands: ZN
Released: 19 Oct 2004

Explore 1XKI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1XKI contains 2 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	15-17	3	1
β-strand	18-23	6	2
β-strand	39-43	5	1
β-strand	49-54	6	1
β-strand	63-68	6	1
β-strand	69-70	2	2
β-strand	76-79	4	2
α-helix	80-82	3
β-strand	84-90	7	2
β-strand	96-103	8	2
β-strand	110-117	8	2
α-helix	127-136	10
β-strand	144-145	2	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Von Ebner's gland protein	A	protein	162	Homo sapiens	P31025 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1XKI_1 Von Ebner's gland protein (chains A)
ASDEEIQDVSGTWYLKAMTVDREFPEMNLESVTPMTLTTLEGGNLEAKVTMLISGRCQEV
KAVLEKTDEPGKYTADGGKHVAYIIRSHVKDHYIFYSEGELHGKPVRGVKLVGRDPKNNL
EALEDFEKAAGARGLSTESILIPRQSETCSPGSAWSHPQFEK

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	3

Water and common crystallization additives (CL) are not listed.

Primary citation

The 1.8-A crystal structure of human tear lipocalin reveals an extended branched cavity with capacity for multiple ligands. Breustedt, D.A., Korndoerfer, I.P., Redl, B. et al. J Biol Chem (2005) 280:484-493. DOI 10.1074/jbc.M410466200 · PubMed

Other PDB entries of the same protein (UniProt P31025 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4QAF 1.8 Å, Crystal structure of an engineered lipocalin (Anticalin) in complex with VEGF(8-109)
3EYC 2.6 Å, New crystal structure of human tear lipocalin in complex with 1,4-butanediol in space…
5T43 NMR Structure of Apo-form Human Tear Lipocalin

Browse structure collections

About this viewer

MolViewer shows 1XKI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.