1XKS: Nuclear pore complex protein Nup133

The crystal structure of the N-terminal domain of Nup133 reveals a beta-propeller fold common to several nucleoporins. Determined by X-ray diffraction at 2.35 Å resolution. Released 7 Dec 2004.

Method: X-ray diffraction
Resolution: 2.35 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,940
Mol. weight: 48.8 kDa
Released: 7 Dec 2004

Explore 1XKS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1XKS contains 14 α-helices and 32 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 32 β-strands

Element	Residues	Length	Sheet
β-strand	79-83	5	1
α-helix	87-89	3
α-helix	90-98	9
β-strand	105-109	5	2
β-strand	114-119	6	2
β-strand	122-127	6	2
α-helix	134-136	3
β-strand	139-143	5	2
α-helix	144-146	3
α-helix	150-151	2
α-helix	153-155	3
β-strand	156-160	5	3
β-strand	173-178	6	3
β-strand	183-187	5	3
β-strand	197-200	4	3
β-strand	209-215	7	4
β-strand	219-224	6	4
β-strand	229-234	6	4
β-strand	240-244	5	4
α-helix	245	1
β-strand	274-280	7	5
β-strand	285-290	6	5
β-strand	293-299	7	5
β-strand	304-311	8	5
α-helix	312-325	14
α-helix	331-335	5
β-strand	339-348	10	6
β-strand	351-359	9	6
β-strand	367	1	7
β-strand	368-375	8	6
β-strand	378	1	8
β-strand	381	1	8
β-strand	386-390	5	6
α-helix	395	1
β-strand	396	1	7
α-helix	397	1
α-helix	400-402	3
β-strand	406-408	3	9
β-strand	416-420	5	9
β-strand	424-429	6	9
α-helix	436-439	4
β-strand	440-443	4	9
α-helix	446-448	3
β-strand	451-457	7	1
β-strand	460-465	6	1
β-strand	469-475	7	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nuclear pore complex protein Nup133	A	protein	450	Homo sapiens	Q8WUM0 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1XKS_1 Nuclear pore complex protein Nup133 (chains A)
GSMFPHHSITESVNYDVKTFGSSLPVKVMEALTLAEVDDQLTINIDEGGWACLVCKEKLI
IWKIALSPITKLSVCKELQLPPSDFHWSADLVALSYSSPSGEAHSTQAVAVMVATREGSI
RYWPSLAGEDTYTEAFVDSGGDKTYSFLTAVQGGSFILSSSGSQLIRLIPESSGKIHQHI
LPQGQGMLSGIGRKVSSLFGILSPSSDLTLSSVLWDRERSSFYSLTSSNISKWELDDSSE
KHAYSWDINRALKENITDAIWGSESNYEAIKEGVNIRYLDLKQNCDGLVILAAAWHSADN
PCLIYYSLITIEDNGCQMSDAVTVEVTQYNPPFQSEDLILCQLTVPNFSNQTAYLYNESA
VYVCSTGTGKFSLPQEKIVFNAQGDSVLGAGACGGVPIIFSRNSGLVSITSRENVSILAE
DLEGSLASSVAGPNSESMIFETTTKNETIA

Primary citation

Structural and functional analysis of Nup133 domains reveals modular building blocks of the nuclear pore complex. Berke, I.C., Boehmer, T., Blobel, G. et al. J Cell Biol (2004) 167:591-597. DOI 10.1083/jcb.200408109 · PubMed

Other PDB entries of the same protein (UniProt Q8WUM0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3CQC 2.53 Å, Nucleoporin Nup107/Nup133 interaction complex
3CQG 3.0 Å, Nucleoporin Nup107/Nup133 interaction complex, delta finger mutant
3I4R 3.53 Å, Nup107(aa658-925)/Nup133(aa517-1156) complex, H.sapiens
7R5K 12.0 Å, Human nuclear pore complex (constricted)
5A9Q 23.0 Å, Human nuclear pore complex
7PEQ 35.0 Å, Model of the outer rings of the human nuclear pore complex
7R5J 50.0 Å, Human nuclear pore complex (dilated)
9A25 Molecular assembly pathway of the human Nuclear Pore Complex after cell division
9A8T Integrative spatiotemporal modeling of biomolecular processes: application to the…

Browse structure collections

About this viewer

MolViewer shows 1XKS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.