1XNB: Xylanase

High-resolution structures of xylanases from B. Circulans and T. Harzianum identify a new folding pattern and implications for the atomic basis of the catalysis. Determined by X-ray diffraction at 1.49 Å resolution. Released 20 Dec 1994.

Method: X-ray diffraction
Resolution: 1.49 Å
Organism: Bacillus circulans
Chains: 1
Atoms: 1,607
Mol. weight: 20.51 kDa
Released: 20 Dec 1994

Explore 1XNB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1XNB contains 3 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	5-10	6	1
β-strand	15-20	6	2
β-strand	25-31	7	2
β-strand	35-42	8	1
β-strand	50-61	12	2
β-strand	64-73	10	1
β-strand	77-85	9	1
β-strand	93-100	8	1
β-strand	103-116	14	1
β-strand	122-132	11	1
α-helix	135-137	3
β-strand	142-145	4	2
α-helix	146-155	10
α-helix	159-161	3
β-strand	163-174	12	1
β-strand	177-184	8	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Xylanase	A	protein	185	Bacillus circulans	P09850 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1XNB_1 XYLANASE (chains A)
ASTDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGNFVVGKGWTTGSPFRTINYNAGVWAP
NGNGYLTLYGWTRSPLIEYYVVDSWGTYRPTGTYKGTVKSDGGTYDIYTTTRYNAPSIDG
DRTTFTQYWSVRQSKRPTGSNATITFTNHVNAWKSHGMNLGSNWAYQVMATEGYQSSGSS
NVTVW

Primary citation

High-Resolution Structures of Xylanases from B. Circulans and T. Harzianum Identify a New Folding Pattern and Implications for the Atomic Basis of the Catalysis. Campbell, R.L., Rose, D.R., Wakarchuk, W.W. et al. To be published.

Other PDB entries of the same protein (UniProt P09850 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8QY3 1.24 Å, Xylanase from Bacillus circulans mutant E78Q/F125A bound to xylotriose
8R85 1.3 Å, Xylanase from Bacillus circulans mutant E78Q/W9A
8QXY 1.41 Å, Xylanase from Bacillus circulans mutant E78Q bound to xylotriose
2BVV 1.5 Å, Sugar ring distortion in the glycosyl-enzyme intermediate of a family G/11 xylanase.
8QXZ 1.5 Å, Xylanase from Bacillus circulans mutant E78Q/Y69A
8R86 1.5 Å, Xylanase from Bacillus circulans mutant E78Q/W71A
1C5H 1.55 Å, Hydrogen bonding and catalysis: an unexpected explanation for how a single amino acid…
3VZK 1.55 Å, Crystal structure of the Bacillus circulans endo-beta-(1,4)-xylanase (BcX) N35E mutant
1HV0 1.6 Å, Dissecting electrostatic interactions and the PH-dependent activity of a family 11…
1XNC 1.6 Å, Thermostabilization of the bacillus circulans xylanase, by the introduction of disulfide…
3VZN 1.67 Å, Crystal structure of the Bacillus circulans endo-beta-(1,4)-xylanase (BcX) N35E mutant…
8QY2 1.7 Å, Xylanase from Bacillus circulans mutant E78Q/F125A

Browse structure collections

About this viewer

MolViewer shows 1XNB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.