High-resolution structures of xylanases from B. Circulans and T. Harzianum identify a new folding pattern and implications for the atomic basis of the catalysis. Determined by X-ray diffraction at 1.49 Å resolution. Released 20 Dec 1994.
Explore 1XNB in 3D Show helices and sheets RCSB PDB PDBe
1XNB contains 3 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 5-10 | 6 | 1 |
| β-strand | 15-20 | 6 | 2 |
| β-strand | 25-31 | 7 | 2 |
| β-strand | 35-42 | 8 | 1 |
| β-strand | 50-61 | 12 | 2 |
| β-strand | 64-73 | 10 | 1 |
| β-strand | 77-85 | 9 | 1 |
| β-strand | 93-100 | 8 | 1 |
| β-strand | 103-116 | 14 | 1 |
| β-strand | 122-132 | 11 | 1 |
| α-helix | 135-137 | 3 | |
| β-strand | 142-145 | 4 | 2 |
| α-helix | 146-155 | 10 | |
| α-helix | 159-161 | 3 | |
| β-strand | 163-174 | 12 | 1 |
| β-strand | 177-184 | 8 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Xylanase | A | protein | 185 | Bacillus circulans | P09850 (AlphaFold model) |
>1XNB_1 XYLANASE (chains A) ASTDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGNFVVGKGWTTGSPFRTINYNAGVWAP NGNGYLTLYGWTRSPLIEYYVVDSWGTYRPTGTYKGTVKSDGGTYDIYTTTRYNAPSIDG DRTTFTQYWSVRQSKRPTGSNATITFTNHVNAWKSHGMNLGSNWAYQVMATEGYQSSGSS NVTVW
High-Resolution Structures of Xylanases from B. Circulans and T. Harzianum Identify a New Folding Pattern and Implications for the Atomic Basis of the Catalysis. Campbell, R.L., Rose, D.R., Wakarchuk, W.W. et al. To be published.
Other PDB entries of the same protein (UniProt P09850 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1XNB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.