1XT6: S35C Flavodoxin Mutant in the semiquinone state

S35C Flavodoxin Mutant in the semiquinone state. Determined by X-ray diffraction at 1.8 Å resolution. Released 21 Dec 2004.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Desulfovibrio vulgaris subsp. vulgaris
Chains: 1
Atoms: 1,261
Mol. weight: 16.15 kDa
Ligands: FMN
Released: 21 Dec 2004

Explore 1XT6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1XT6 contains 7 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	3-9	7	1
α-helix	14-28	15
β-strand	32-37	6	1
α-helix	38-40	3
β-strand	52-57	6	1
β-strand	59-60	2	2
β-strand	66-67	2	2
α-helix	71-76	6
α-helix	78-80	3
β-strand	87-94	8	1
α-helix	103-114	12
β-strand	118-119	2	1
β-strand	124-127	4	1
α-helix	130-132	3
α-helix	134-147	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Flavodoxin	A	protein	147	Desulfovibrio vulgaris subsp. vulgaris	P00323 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1XT6_1 Flavodoxin (chains A)
AKALIVYGSTTGNTEYTAETIARELADAGYEVDCRDAASVEAGGLFEGFDLVLLGCSTWG
DDSIELQDDFIPLFDSLEETGAQGRKVACFGCGDSSYEYFCGAVDAIEEKLKNLGAEIVQ
DGLRIDGDPRAARDDIVGWAHDVRGAI

Ligands and cofactors

ID	Name	Formula	Copies
FMN	Flavin mononucleotide	C17 H21 N4 O9 P	1

Primary citation

Structure of S35C flavodoxin mutant from Desulfovibrio vulgaris in the semiquinone state. Artali, R., Marchini, N., Meneghetti, F. et al. Acta Crystallogr D Biol Crystallogr (2005) 61:481-484. DOI 10.1107/S0907444905001502 · PubMed

Other PDB entries of the same protein (UniProt P00323 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5YOB 1.14 Å, Crystal Structure of flavodoxin without engineered disulfide bond
1F4P 1.3 Å, Y98W flavodoxin mutant 1.5A (D. Vulgaris)
1J8Q 1.35 Å, Low Temperature (100K) Crystal Structure of Flavodoxin D. vulgaris Wild-type at 1.35…
5YOE 1.35 Å, Crystal Structure of flavodoxin with engineered disulfide bond A43C-L74C
5YOG 1.42 Å, Crystal Structure of flavodoxin with engineered disulfide bond N14C-C93
1J9E 1.44 Å, Low Temperature (100K) Crystal Structure of Flavodoxin D. vulgaris S35C Mutant at 1.44…
5YOC 1.5 Å, Crystal Structure of flavodoxin with engineered disulfide bond C102-R125C
1AKR 1.58 Å, G61A oxidized flavodoxin mutant
1WSW 1.69 Å, Low Temperature (100K) Crystal Structure Of Flavodoxin Mutant S64C, dimer, semiquinone…
1XYY 1.7 Å, Low Temperature (100K) Crystal Structure Of Flavodoxin Mutant S64C, homodimer, oxidised…
1AKW 1.75 Å, G61L oxidized flavodoxin mutant
1XYV 1.79 Å, Low Temperature (100K) Crystal Structure Of Flavodoxin Mutant S64C, monomer, semiquinone…

Browse structure collections

About this viewer

MolViewer shows 1XT6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.