Crystal Structure of Den1 in complex with Nedd8. Determined by X-ray diffraction at 2.2 Å resolution. Released 21 Dec 2004.
Explore 1XT9 in 3D Show helices and sheets RCSB PDB PDBe
1XT9 contains 15 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-8 | 5 | 1 |
| β-strand | 11-14 | 4 | 1 |
| α-helix | 15-19 | 5 | |
| α-helix | 25-26 | 2 | |
| β-strand | 27-28 | 2 | 2 |
| α-helix | 29-38 | 10 | |
| α-helix | 39-43 | 5 | |
| α-helix | 45-47 | 3 | |
| β-strand | 51-54 | 4 | 3 |
| α-helix | 56-64 | 9 | |
| α-helix | 71-75 | 5 | |
| α-helix | 76-78 | 3 | |
| α-helix | 80-82 | 3 | |
| β-strand | 85-91 | 7 | 3 |
| β-strand | 99 | 1 | 4 |
| β-strand | 103-109 | 7 | 3 |
| β-strand | 114-118 | 5 | 3 |
| α-helix | 126-134 | 9 | |
| β-strand | 148-151 | 4 | 3 |
| α-helix | 163-179 | 17 | |
| α-helix | 186-189 | 4 | |
| α-helix | 192-210 | 19 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-7 | 6 | 5 |
| β-strand | 12-16 | 5 | 5 |
| β-strand | 22 | 1 | 6 |
| α-helix | 23-34 | 12 | |
| α-helix | 38-40 | 3 | |
| β-strand | 41-45 | 5 | 5 |
| β-strand | 48-49 | 2 | 5 |
| β-strand | 55 | 1 | 6 |
| β-strand | 66-71 | 6 | 5 |
| β-strand | 73 | 1 | 4 |
| β-strand | 74-75 | 2 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Sentrin-specific protease 8 | A | protein | 212 | Homo sapiens | Q96LD8 (AlphaFold model) |
| Neddylin | B | protein | 76 | Homo sapiens | Q15843 (AlphaFold model) |
>1XT9_1 Sentrin-specific protease 8 (chains A) MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQ FIKCTSNPAEIAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDS HSRSNSVHAKQVAEKLEAFLGRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFR QQTESLLQLLTPAYITKKRGEWKDLITTLAKK
>1XT9_2 Neddylin (chains B) MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYK ILGGSVLHLVLALRGG
Structure of a Complex between Nedd8 and the Ulp/Senp Protease Family Member Den1. Reverter, D., Wu, K., Erdene, T.G. et al. J Mol Biol (2005) 345:141-151. DOI 10.1016/j.jmb.2004.10.022 · PubMed
Other PDB entries of the same protein (UniProt Q96LD8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1XT9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.