1XU1: APRIL

The crystal structure of APRIL bound to TACI. Determined by X-ray diffraction at 1.9 Å resolution. Released 9 Nov 2004.

Method: X-ray diffraction
Resolution: 1.9 Å
Organisms: Mus musculus, Homo sapiens
Chains: 6
Atoms: 4,280
Mol. weight: 61.41 kDa
Ligands: NI
Released: 9 Nov 2004

Explore 1XU1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1XU1 contains 13 α-helices and 39 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	108-117	10	1
β-strand	125-135	11	1
β-strand	139-142	4	1
β-strand	145-148	4	1
β-strand	152-163	12	1
β-strand	168-177	10	1
β-strand	180-190	11	1
β-strand	199-210	12	1
β-strand	215-220	6	1
β-strand	227	1	1
β-strand	235-240	6	1

Chain B: 1 helix, 11 β-strands

Element	Residues	Length	Sheet
β-strand	108-117	10	2
β-strand	125-135	11	2
β-strand	139-142	4	2
β-strand	145-148	4	2
β-strand	152-163	12	2
β-strand	168-177	10	2
β-strand	180-190	11	2
α-helix	195-197	3
β-strand	199-210	12	2
β-strand	215-220	6	2
β-strand	227	1	2
β-strand	235-240	6	2

Chain D: 0 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	108-117	10	3
β-strand	125-135	11	3
β-strand	139-142	4	3
β-strand	145-148	4	3
β-strand	152-163	12	3
β-strand	168-176	9	3
β-strand	181-190	10	3
β-strand	199-210	12	3
β-strand	215-220	6	3
β-strand	227	1	3
β-strand	235-240	6	3

Chain R: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	73-75	3
β-strand	77-80	4	4
β-strand	85-88	4	4
α-helix	89-92	4
α-helix	98-100	3
α-helix	101-104	4

Chain S: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	73-75	3
β-strand	77-80	4	5
β-strand	85-88	4	5
α-helix	89-92	4
α-helix	98-100	3
α-helix	101-105	5

Chain T: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	73-75	3
β-strand	77-80	4	6
β-strand	85-88	4	6
α-helix	89-91	3
α-helix	98-100	3
α-helix	101-106	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tumor necrosis factor ligand superfamily member 13	A, B, D	protein	138	Mus musculus	Q9D777 (AlphaFold model)
Tumor necrosis factor receptor superfamily member 13B	R, S, T	protein	42	Homo sapiens	O14836 (AlphaFold model)

Sequence of entity 1 (A, B, D), FASTA

>1XU1_1 Tumor necrosis factor ligand superfamily member 13 (chains A, B, D)
KKHSVLHLVPVNITSKADSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYLLYSQVLFH
DVTFTMGQVVSREGQGRRETLFRCIRSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRA
NAKLSLSPHGTFLGFVKL

Sequence of entity 2 (R, S, T), FASTA

>1XU1_2 Tumor necrosis factor receptor superfamily member 13B (chains R, S, T)
SLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLR

Ligands and cofactors

ID	Name	Formula	Copies
NI	Nickel (II) ion	Ni	1

Primary citation

Structures of APRIL-receptor complexes: Like BCMA, TACI employs only a single cysteine-rich domain for high-affinity ligand binding. Hymowitz, S.G., Patel, D.R., Wallweber, H.J.A. et al. J Biol Chem (2005) 280:7218-7227. DOI 10.1074/jbc.M411714200 · PubMed

Other PDB entries of the same protein (UniProt Q9D777 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1U5X 1.8 Å, Crystal structure of murine APRIL at pH 5.0
1U5Y 2.3 Å, Crystal structure of murine APRIL, pH 8.0
1XU2 2.35 Å, The crystal structure of APRIL bound to BCMA
1U5Z 2.4 Å, The Crystal structure of murine APRIL, pH 8.5
3K48 2.8 Å, Crystal structure of APRIL bound to a peptide

Browse structure collections

About this viewer

MolViewer shows 1XU1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.