1Y76: Patj/Pals1 L27 Domain Complex

Solution Structure of Patj/Pals1 L27 Domain Complex. Determined by solution NMR. Released 19 Apr 2005.

Method: Solution NMR
Organisms: Rattus norvegicus, Homo sapiens
Chains: 4
Atoms: 1,954
Mol. weight: 27.84 kDa
Released: 19 Apr 2005

Explore 1Y76 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1Y76 contains 12 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	5-26	22
α-helix	32-43	12
α-helix	45-63	19

Chain B: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	86-100	15
α-helix	104-117	14
α-helix	119-137	19

Chain C: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	6-26	21
α-helix	32-43	12
α-helix	45-63	19

Chain D: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	86-99	14
α-helix	104-117	14
α-helix	119-137	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
protein associated to tight junctions	A, C	protein	62	Rattus norvegicus	O55164 (AlphaFold model)
MAGUK p55 subfamily member 5	B, D	protein	60	Homo sapiens	Q8N3R9 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>1Y76_1 protein associated to tight junctions (chains A, C)
NPAAEKMQVLQVLDRLRGKLQEKGDTTQNEKLSAFYETLKSPLFNQILTLQQSIKQLKGQ
LS

Sequence of entity 2 (B, D), FASTA

>1Y76_2 MAGUK p55 subfamily member 5 (chains B, D)
AVKILEIEDLFSSLKHIQHTLVDSQSQEDISLLLQLVQNKDFQNAFKIHNAITVHMNKAS

Primary citation

A unified assembly mode revealed by the structures of tetrameric L27 domain complexes formed by mLin-2/mLin-7 and Patj/Pals1 scaffold proteins. Feng, W., Long, J.F., Zhang, M. Proc Natl Acad Sci U S A (2005) 102:6861-6866. DOI 10.1073/pnas.0409346102 · PubMed

Other PDB entries of the same protein (UniProt O55164 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5DTH 1.95 Å, Crystal structure of MUPP1 PDZ8 domain from rattus norvegicus

Browse structure collections

About this viewer

MolViewer shows 1Y76 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.