5DTH: MUPP1 PDZ8 domain from rattus norvegicus

Crystal structure of MUPP1 PDZ8 domain from rattus norvegicus. Determined by X-ray diffraction at 1.95 Å resolution. Released 14 Sept 2016.

Method: X-ray diffraction
Resolution: 1.95 Å
Organism: Rattus norvegicus
Chains: 4
Atoms: 3,420
Mol. weight: 48.93 kDa
Released: 14 Sept 2016

Explore 5DTH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5DTH contains 17 α-helices and 28 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	1321-1328	8
β-strand	1334-1341	8	1
β-strand	1349-1353	5	1
β-strand	1362-1367	6	1
α-helix	1372-1376	5
α-helix	1383	1
β-strand	1384-1388	5	1
β-strand	1391-1392	2	1
α-helix	1398-1407	10
β-strand	1411-1418	8	1

Chain C: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	1321-1328	8
β-strand	1334-1341	8	3
β-strand	1343	1	4
β-strand	1346	1	4
β-strand	1349-1354	6	3
β-strand	1361-1367	7	3
α-helix	1372-1376	5
α-helix	1383	1
β-strand	1384-1388	5	3
β-strand	1391-1392	2	3
α-helix	1398-1407	10
β-strand	1411-1418	8	3

Chain D: 5 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	1315-1317	3
α-helix	1321-1328	8
β-strand	1334-1341	8	5
β-strand	1343	1	6
β-strand	1346	1	6
β-strand	1349-1355	7	5
β-strand	1360-1367	8	5
α-helix	1372-1376	5
α-helix	1383	1
β-strand	1384-1388	5	5
β-strand	1391-1392	2	5
α-helix	1398-1407	10
β-strand	1411-1418	8	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Multiple PDZ domain protein	A, B, C, D	protein	111	Rattus norvegicus	O55164 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>5DTH_1 Multiple PDZ domain protein (chains A, B, C, D)
DKEDEFGYSWKNIQERYGTLTGQLHMIELEKGHSGLGLSLAGNKDRTRMSVFIVGIDPTG
AAGRDGRLQIADELLEINGQILYGRSHQNASSIIKCAPSKVKIIFIRNADA

Primary citation

Crystal structure and biochemical characteristics of MUPP1 PDZ8 domain from rattus norregicus. Lv, Y., Li, J., Zhu, H. et al. To be published.

Other PDB entries of the same protein (UniProt O55164 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1Y76 Solution Structure of Patj/Pals1 L27 Domain Complex

Browse structure collections

About this viewer

MolViewer shows 5DTH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.