Crystal structure of MUPP1 PDZ8 domain from rattus norvegicus. Determined by X-ray diffraction at 1.95 Å resolution. Released 14 Sept 2016.
Explore 5DTH in 3D Show helices and sheets RCSB PDB PDBe
5DTH contains 17 α-helices and 28 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1321-1328 | 8 | |
| β-strand | 1334-1341 | 8 | 1 |
| β-strand | 1349-1353 | 5 | 1 |
| β-strand | 1362-1367 | 6 | 1 |
| α-helix | 1372-1376 | 5 | |
| α-helix | 1383 | 1 | |
| β-strand | 1384-1388 | 5 | 1 |
| β-strand | 1391-1392 | 2 | 1 |
| α-helix | 1398-1407 | 10 | |
| β-strand | 1411-1418 | 8 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1321-1328 | 8 | |
| β-strand | 1334-1341 | 8 | 3 |
| β-strand | 1343 | 1 | 4 |
| β-strand | 1346 | 1 | 4 |
| β-strand | 1349-1354 | 6 | 3 |
| β-strand | 1361-1367 | 7 | 3 |
| α-helix | 1372-1376 | 5 | |
| α-helix | 1383 | 1 | |
| β-strand | 1384-1388 | 5 | 3 |
| β-strand | 1391-1392 | 2 | 3 |
| α-helix | 1398-1407 | 10 | |
| β-strand | 1411-1418 | 8 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1315-1317 | 3 | |
| α-helix | 1321-1328 | 8 | |
| β-strand | 1334-1341 | 8 | 5 |
| β-strand | 1343 | 1 | 6 |
| β-strand | 1346 | 1 | 6 |
| β-strand | 1349-1355 | 7 | 5 |
| β-strand | 1360-1367 | 8 | 5 |
| α-helix | 1372-1376 | 5 | |
| α-helix | 1383 | 1 | |
| β-strand | 1384-1388 | 5 | 5 |
| β-strand | 1391-1392 | 2 | 5 |
| α-helix | 1398-1407 | 10 | |
| β-strand | 1411-1418 | 8 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Multiple PDZ domain protein | A, B, C, D | protein | 111 | Rattus norvegicus | O55164 (AlphaFold model) |
>5DTH_1 Multiple PDZ domain protein (chains A, B, C, D) DKEDEFGYSWKNIQERYGTLTGQLHMIELEKGHSGLGLSLAGNKDRTRMSVFIVGIDPTG AAGRDGRLQIADELLEINGQILYGRSHQNASSIIKCAPSKVKIIFIRNADA
Crystal structure and biochemical characteristics of MUPP1 PDZ8 domain from rattus norregicus. Lv, Y., Li, J., Zhu, H. et al. To be published.
Other PDB entries of the same protein (UniProt O55164 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5DTH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.