1Y8F: Munc13-1 C1-domain

Solution structure of the munc13-1 C1-domain. Determined by solution NMR. Released 12 Apr 2005.

Method: Solution NMR
Organism: Rattus norvegicus
Chains: 1
Atoms: 406
Mol. weight: 7.25 kDa
Ligands: ZN
Released: 12 Apr 2005

Explore 1Y8F in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1Y8F contains 2 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	569-573	5	1
β-strand	593-597	5	1
β-strand	603-604	2	1
α-helix	608-611	4
α-helix	613-614	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Unc-13 homolog A	A	protein	66	Rattus norvegicus	Q62768 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1Y8F_1 Unc-13 homolog A (chains A)
GSPGISGGGGGIQHNFEVWTATTPTYCYECEGLLWGIARQGMRCTECGVKCHEKCQDLLN
ADCKLN

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

Intramolecular occlusion of the diacylglycerol-binding site in the C1 domain of munc13-1. Shen, N., Guryev, O., Rizo, J. Biochemistry (2005) 44:1089-1096. DOI 10.1021/bi0476127 · PubMed

Other PDB entries of the same protein (UniProt Q62768 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6NYT 1.37 Å, Munc13-1 C2B-domain, calcium bound
2CJT 1.44 Å, Structural Basis for a Munc13-1 Homodimer - Munc13-1 - RIM Heterodimer Switch:…
2CJS 1.78 Å, Structural Basis for a Munc13-1 Homodimer - Munc13-1 - RIM Heterodimer Switch:…
6NYC 1.89 Å, Munc13-1 C2B-domain, calcium free
3SWH 2.65 Å, Munc13-1, MUN domain, C-terminal module
6A30 2.79 Å, Crystal Structure of Munc13-1 MUN Domain and Synaptobrevin-2 Juxtamembrane Linker Region
5UF7 2.9 Å, Crystal structure of MUNC13-1 mun domain
4Y21 2.9 Å, Crystal Structure of Munc13-1 MUN domain
5UE8 3.35 Å, The crystal structure of Munc13-1 C1C2BMUN domain
7T7X 10.0 Å, Munc13-1 C1-C2B-MUN-C2C Upright conformation spanning two lipid bilayers
7T81 10.0 Å, Model of Munc13-1 C1-C2B-MUN-C2C 2D crystal between lipid bilayers.
2KDU Structural basis of the Munc13-1/Ca2+-Calmodulin interaction: A novel 1-26 calmodulin…

Browse structure collections

About this viewer

MolViewer shows 1Y8F directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.