short form HGFA with first Kunitz domain from HAI-1. Determined by X-ray diffraction at 2.6 Å resolution. Released 15 Feb 2005.
Explore 1YC0 in 3D Show helices and sheets RCSB PDB PDBe
1YC0 contains 15 α-helices and 30 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 409 | 1 | 1 |
| β-strand | 412-413 | 2 | 2 |
| α-helix | 414-415 | 2 | |
| β-strand | 422-427 | 6 | 3 |
| β-strand | 430-438 | 9 | 3 |
| β-strand | 441-444 | 4 | 3 |
| α-helix | 446-449 | 4 | |
| α-helix | 455-457 | 3 | |
| β-strand | 458-462 | 5 | 3 |
| β-strand | 466 | 1 | 4 |
| β-strand | 475-477 | 3 | 3 |
| β-strand | 479-484 | 6 | 3 |
| β-strand | 499-503 | 5 | 3 |
| α-helix | 504-505 | 2 | |
| β-strand | 506 | 1 | 5 |
| β-strand | 509 | 1 | 5 |
| β-strand | 514 | 1 | 6 |
| β-strand | 517 | 1 | 6 |
| α-helix | 519-520 | 2 | |
| β-strand | 521 | 1 | 2 |
| α-helix | 522 | 1 | |
| β-strand | 534-539 | 6 | 2 |
| β-strand | 544 | 1 | 7 |
| β-strand | 547 | 1 | 7 |
| β-strand | 553 | 1 | 4 |
| β-strand | 555-561 | 7 | 2 |
| α-helix | 562-563 | 2 | |
| α-helix | 564-567 | 4 | |
| α-helix | 574-576 | 3 | |
| β-strand | 581-584 | 4 | 2 |
| β-strand | 592 | 1 | 1 |
| β-strand | 601-606 | 6 | 2 |
| β-strand | 609-618 | 10 | 2 |
| β-strand | 629-633 | 5 | 2 |
| α-helix | 634-637 | 4 | |
| α-helix | 638-644 | 7 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 241-246 | 6 | |
| α-helix | 247-251 | 5 | |
| α-helix | 253-254 | 2 | |
| β-strand | 259 | 1 | 2 |
| β-strand | 262 | 1 | 3 |
| β-strand | 263-269 | 7 | 8 |
| β-strand | 274-280 | 7 | 8 |
| β-strand | 290 | 1 | 8 |
| α-helix | 293-299 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Hepatocyte growth factor activator | A | protein | 283 | Homo sapiens | Q04756 (AlphaFold model) |
| Kunitz-type protease inhibitor 1 | I | protein | 75 | Homo sapiens | O43278 (AlphaFold model) |
>1YC0_1 Hepatocyte growth factor activator (chains A) VQLSPDLLATLPEPASPGRQACGRRHKKRTFLRPRIIGGSSSLPGSHPWLAAIYIGDSFC AGSLVHTCWVVSAAHCFSHSPPRDSVSVVLGQHFFNRTTDVTQTFGIEKYIPYTLYSVFN PSDHDLVLIRLKKKGDRCATRSQFVQPICLPEPGSTFPAGHKCQIAGWGHLDENVSGYSS SLREALVPLVADHKCSSPEVYGADISPNMLCAGYFDCKSDACQGDSGGPLACEKNGVAYL YGIISWGDGCGRLHKPGVYTRVANYVDWINDRIRPPRRLVAPS
>1YC0_2 Kunitz-type protease inhibitor 1 (chains I) MKHQHQHQHQHQHQMHQTEDYCLASNKVGRCRGSFPRWYYDPTEQICKSFVYGGCLGNKN NYLREEECILACRGV
| ID | Name | Formula | Copies |
|---|---|---|---|
| PO4 | Phosphate ion | O4 P | 1 |
Conformational lability in serine protease active sites: structures of hepatocyte growth factor activator (HGFA) alone and with the inhibitory domain from HGFA inhibitor-1B. Shia, S., Stamos, J., Kirchhofer, D. et al. J Mol Biol (2005) 346:1335-1349. DOI 10.1016/j.jmb.2004.12.048 · PubMed
Other PDB entries of the same protein (UniProt Q04756 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1YC0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.